Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZV36

Protein Details
Accession E4ZV36   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-60IPSAPQPNEKGKKKKKKNPRPKNTAFPAAGHydrophilic
NLS Segment(s)
PositionSequence
39-52EKGKKKKKKNPRPK
Subcellular Location(s) mito 13, cyto 8, nucl 6
Family & Domain DBs
Amino Acid Sequences MHPASPFFRLRDGSHRLTGTAPTAQTRGLAIPSAPQPNEKGKKKKKKNPRPKNTAFPAAGRVAMAACREPCAVYGRLAFSCRGAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.39
4 0.37
5 0.35
6 0.29
7 0.25
8 0.21
9 0.17
10 0.18
11 0.17
12 0.16
13 0.15
14 0.13
15 0.1
16 0.1
17 0.08
18 0.1
19 0.13
20 0.17
21 0.16
22 0.16
23 0.19
24 0.27
25 0.36
26 0.42
27 0.49
28 0.56
29 0.67
30 0.76
31 0.83
32 0.85
33 0.88
34 0.92
35 0.92
36 0.93
37 0.92
38 0.89
39 0.9
40 0.84
41 0.81
42 0.71
43 0.61
44 0.54
45 0.44
46 0.37
47 0.27
48 0.21
49 0.13
50 0.13
51 0.12
52 0.11
53 0.11
54 0.13
55 0.13
56 0.13
57 0.15
58 0.18
59 0.18
60 0.18
61 0.21
62 0.22
63 0.24
64 0.25
65 0.25