Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZLU9

Protein Details
Accession E4ZLU9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79GTVRCSRRTKPGPPQPTRHGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, plas 4, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTCLHGPVCSEHPVLVLLVLLVLLSGSGGCLWVGFAASLSMYHVHGRFAVCQLLAHLLTGTVRCSRRTKPGPPQPTRHGASVVFEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.1
4 0.06
5 0.05
6 0.05
7 0.04
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.04
27 0.05
28 0.05
29 0.07
30 0.07
31 0.07
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.1
41 0.1
42 0.09
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.13
49 0.14
50 0.18
51 0.23
52 0.27
53 0.37
54 0.44
55 0.52
56 0.57
57 0.67
58 0.74
59 0.77
60 0.82
61 0.78
62 0.79
63 0.73
64 0.65
65 0.57
66 0.47
67 0.44