Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZIY0

Protein Details
Accession E4ZIY0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
261-288AMEQLAKTEKRRPKKLRKGGSRLPMPTAHydrophilic
NLS Segment(s)
PositionSequence
117-138GVGKAWRRMKKGLRPGDKVKKK
268-283TEKRRPKKLRKGGSRL
Subcellular Location(s) nucl 10.5, mito_nucl 9.666, mito 7.5, cyto_mito 7.333, cyto 5
Family & Domain DBs
Amino Acid Sequences MTEAQKQANGNAMTWKRAIKKAAVCLAALEYLVLDSTDAQKPRNTDAAEKRQVCDSASTMAFPLDVYPVMSEISELREKANVDGAAPALEADLLSSASPQHSASGTSSLATPTSKGGVGKAWRRMKKGLRPGDKVKKKADTTIPASVSSRGTASASNGTSRCERGETGSSHAACTQLDDCSLNSSIAVGPASSKGTISDEQDSEAAKDMGSASDKDDVSTSDWFMTHGLTVEAATELLQWGGLGDDEEDITALPSMSLKSAMEQLAKTEKRRPKKLRKGGSRLPMPTAKWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.37
4 0.41
5 0.44
6 0.43
7 0.47
8 0.53
9 0.58
10 0.53
11 0.47
12 0.42
13 0.4
14 0.32
15 0.25
16 0.16
17 0.09
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.1
24 0.15
25 0.17
26 0.18
27 0.21
28 0.24
29 0.28
30 0.34
31 0.32
32 0.36
33 0.45
34 0.53
35 0.6
36 0.6
37 0.56
38 0.53
39 0.52
40 0.44
41 0.37
42 0.28
43 0.24
44 0.22
45 0.21
46 0.17
47 0.16
48 0.15
49 0.12
50 0.11
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.11
61 0.13
62 0.13
63 0.13
64 0.15
65 0.16
66 0.17
67 0.21
68 0.17
69 0.15
70 0.16
71 0.15
72 0.12
73 0.12
74 0.11
75 0.05
76 0.05
77 0.04
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.09
91 0.11
92 0.11
93 0.11
94 0.11
95 0.1
96 0.1
97 0.09
98 0.09
99 0.07
100 0.08
101 0.09
102 0.08
103 0.09
104 0.12
105 0.18
106 0.23
107 0.32
108 0.39
109 0.42
110 0.45
111 0.52
112 0.56
113 0.59
114 0.64
115 0.64
116 0.64
117 0.66
118 0.72
119 0.76
120 0.75
121 0.72
122 0.67
123 0.64
124 0.57
125 0.56
126 0.53
127 0.48
128 0.45
129 0.46
130 0.42
131 0.35
132 0.35
133 0.3
134 0.25
135 0.19
136 0.14
137 0.09
138 0.09
139 0.08
140 0.09
141 0.11
142 0.11
143 0.13
144 0.13
145 0.15
146 0.15
147 0.16
148 0.15
149 0.13
150 0.13
151 0.14
152 0.18
153 0.18
154 0.21
155 0.25
156 0.25
157 0.24
158 0.24
159 0.21
160 0.16
161 0.17
162 0.13
163 0.08
164 0.09
165 0.09
166 0.09
167 0.11
168 0.12
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.08
175 0.05
176 0.05
177 0.07
178 0.08
179 0.07
180 0.07
181 0.07
182 0.11
183 0.13
184 0.15
185 0.17
186 0.17
187 0.18
188 0.18
189 0.18
190 0.15
191 0.15
192 0.13
193 0.09
194 0.09
195 0.08
196 0.09
197 0.1
198 0.1
199 0.1
200 0.15
201 0.15
202 0.15
203 0.16
204 0.15
205 0.16
206 0.17
207 0.16
208 0.12
209 0.12
210 0.12
211 0.12
212 0.11
213 0.09
214 0.08
215 0.07
216 0.07
217 0.07
218 0.07
219 0.06
220 0.06
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.06
239 0.05
240 0.05
241 0.06
242 0.06
243 0.07
244 0.08
245 0.08
246 0.09
247 0.14
248 0.16
249 0.18
250 0.18
251 0.22
252 0.31
253 0.35
254 0.37
255 0.43
256 0.5
257 0.57
258 0.68
259 0.75
260 0.77
261 0.84
262 0.91
263 0.92
264 0.94
265 0.94
266 0.92
267 0.91
268 0.89
269 0.81
270 0.77
271 0.72