Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5ADU1

Protein Details
Accession E5ADU1    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-33IPTSADPRSHRPTKKRALPRTALSSHydrophilic
120-147DRERTEKNRAKREKARLRKERAKKGGKGBasic
NLS Segment(s)
PositionSequence
111-152KKKEEQEKRDRERTEKNRAKREKARLRKERAKKGGKGAEDSA
163-171GGKKKLAPR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSADPRSHRPTKKRALPRTALSSQVEALFAKPDRNIQLPNSSLSKSVALPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMDEEVVKEEQQREFLKKKEEQEKRDRERTEKNRAKREKARLRKERAKKGGKGAEDSAREGTPLADEAGGKKKLAPRAEGKGNGETNEEEDANQGGAVKNVEEIGLVIEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.42
4 0.5
5 0.58
6 0.63
7 0.71
8 0.76
9 0.81
10 0.84
11 0.85
12 0.86
13 0.84
14 0.82
15 0.8
16 0.72
17 0.67
18 0.58
19 0.49
20 0.41
21 0.34
22 0.28
23 0.2
24 0.18
25 0.16
26 0.15
27 0.15
28 0.15
29 0.18
30 0.21
31 0.24
32 0.26
33 0.25
34 0.31
35 0.3
36 0.32
37 0.31
38 0.28
39 0.26
40 0.25
41 0.23
42 0.18
43 0.21
44 0.21
45 0.19
46 0.19
47 0.18
48 0.19
49 0.17
50 0.16
51 0.12
52 0.09
53 0.08
54 0.08
55 0.07
56 0.05
57 0.05
58 0.05
59 0.04
60 0.03
61 0.03
62 0.04
63 0.05
64 0.06
65 0.05
66 0.06
67 0.07
68 0.08
69 0.13
70 0.2
71 0.27
72 0.32
73 0.36
74 0.42
75 0.51
76 0.58
77 0.63
78 0.63
79 0.58
80 0.54
81 0.51
82 0.46
83 0.39
84 0.32
85 0.23
86 0.17
87 0.15
88 0.13
89 0.14
90 0.14
91 0.12
92 0.15
93 0.16
94 0.19
95 0.22
96 0.25
97 0.3
98 0.33
99 0.4
100 0.46
101 0.52
102 0.55
103 0.62
104 0.69
105 0.71
106 0.74
107 0.7
108 0.65
109 0.68
110 0.69
111 0.69
112 0.67
113 0.68
114 0.7
115 0.75
116 0.78
117 0.77
118 0.8
119 0.79
120 0.82
121 0.84
122 0.83
123 0.86
124 0.88
125 0.88
126 0.88
127 0.87
128 0.86
129 0.8
130 0.8
131 0.76
132 0.69
133 0.63
134 0.56
135 0.52
136 0.45
137 0.42
138 0.35
139 0.28
140 0.25
141 0.21
142 0.18
143 0.12
144 0.1
145 0.09
146 0.07
147 0.08
148 0.11
149 0.18
150 0.19
151 0.18
152 0.21
153 0.25
154 0.31
155 0.35
156 0.38
157 0.37
158 0.44
159 0.52
160 0.54
161 0.53
162 0.53
163 0.52
164 0.47
165 0.43
166 0.35
167 0.29
168 0.27
169 0.24
170 0.16
171 0.15
172 0.15
173 0.13
174 0.12
175 0.11
176 0.09
177 0.1
178 0.11
179 0.1
180 0.1
181 0.1
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08