Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A101MF78

Protein Details
Accession A0A101MF78    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-108EEKINKIKWCRRQNASHFLLHydrophilic
NLS Segment(s)
PositionSequence
409-430MSKGNGKKAGSRSGSPAGPGSR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000009  PP2A_PR55  
IPR018067  PP2A_PR55_CS  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0000159  C:protein phosphatase type 2A complex  
GO:0019888  F:protein phosphatase regulator activity  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS01024  PR55_1  
PS01025  PR55_2  
Amino Acid Sequences MVDRDPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLATGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNASHFLLSTNDKTIKLWKVFDKSLKVVAENNLSNELTPANPVGGGGMARAPRVSFKDPSALKLPRLTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRVNLWNLNIQDQSFNIVDIKPANMEELTEVITAAEFHPVSCNWFMYASSKGTIKLADMRQRALCDEHAKQFEQEEDASSRSFFSEIISSISDVRFSNDGRYIVSRDYLTVKIWDVNMERQPIKTIPIHEHLRPRLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTQEEKDTEIVLQADKSAFKAKKVGVPTPMSKGNGKKAGSRSGSPAGPGSRMKKETDADQIDFNKKILHMSWHPFEDSIAIAATNNLFVFSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.47
4 0.46
5 0.46
6 0.4
7 0.42
8 0.43
9 0.33
10 0.3
11 0.27
12 0.24
13 0.17
14 0.17
15 0.13
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.08
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.12
40 0.14
41 0.19
42 0.21
43 0.23
44 0.31
45 0.35
46 0.39
47 0.39
48 0.43
49 0.44
50 0.49
51 0.49
52 0.52
53 0.54
54 0.61
55 0.64
56 0.65
57 0.61
58 0.57
59 0.56
60 0.52
61 0.55
62 0.45
63 0.4
64 0.36
65 0.32
66 0.31
67 0.28
68 0.26
69 0.16
70 0.17
71 0.16
72 0.15
73 0.17
74 0.17
75 0.2
76 0.19
77 0.24
78 0.27
79 0.31
80 0.34
81 0.4
82 0.47
83 0.53
84 0.61
85 0.65
86 0.68
87 0.74
88 0.79
89 0.8
90 0.76
91 0.7
92 0.6
93 0.52
94 0.48
95 0.41
96 0.35
97 0.3
98 0.27
99 0.24
100 0.24
101 0.3
102 0.33
103 0.33
104 0.36
105 0.37
106 0.41
107 0.46
108 0.51
109 0.5
110 0.44
111 0.47
112 0.43
113 0.38
114 0.35
115 0.33
116 0.34
117 0.29
118 0.28
119 0.25
120 0.24
121 0.22
122 0.2
123 0.17
124 0.11
125 0.11
126 0.1
127 0.07
128 0.06
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.11
140 0.16
141 0.2
142 0.19
143 0.21
144 0.29
145 0.29
146 0.32
147 0.37
148 0.34
149 0.32
150 0.36
151 0.36
152 0.32
153 0.39
154 0.41
155 0.35
156 0.34
157 0.34
158 0.28
159 0.27
160 0.27
161 0.23
162 0.18
163 0.17
164 0.15
165 0.15
166 0.16
167 0.15
168 0.13
169 0.16
170 0.23
171 0.24
172 0.26
173 0.29
174 0.29
175 0.29
176 0.27
177 0.22
178 0.14
179 0.13
180 0.12
181 0.09
182 0.08
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.06
189 0.06
190 0.07
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.08
199 0.09
200 0.11
201 0.1
202 0.12
203 0.12
204 0.12
205 0.12
206 0.1
207 0.13
208 0.11
209 0.11
210 0.09
211 0.08
212 0.09
213 0.09
214 0.09
215 0.07
216 0.07
217 0.07
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.05
226 0.05
227 0.05
228 0.05
229 0.07
230 0.06
231 0.06
232 0.07
233 0.07
234 0.1
235 0.1
236 0.1
237 0.08
238 0.09
239 0.09
240 0.1
241 0.13
242 0.11
243 0.12
244 0.12
245 0.12
246 0.12
247 0.12
248 0.11
249 0.15
250 0.19
251 0.25
252 0.26
253 0.28
254 0.28
255 0.29
256 0.29
257 0.25
258 0.23
259 0.21
260 0.22
261 0.26
262 0.27
263 0.27
264 0.26
265 0.25
266 0.23
267 0.2
268 0.17
269 0.14
270 0.13
271 0.13
272 0.13
273 0.12
274 0.12
275 0.1
276 0.1
277 0.08
278 0.07
279 0.08
280 0.08
281 0.1
282 0.1
283 0.1
284 0.11
285 0.11
286 0.12
287 0.1
288 0.12
289 0.12
290 0.12
291 0.15
292 0.17
293 0.17
294 0.17
295 0.19
296 0.19
297 0.18
298 0.19
299 0.16
300 0.14
301 0.17
302 0.17
303 0.16
304 0.15
305 0.15
306 0.15
307 0.16
308 0.18
309 0.17
310 0.21
311 0.24
312 0.27
313 0.27
314 0.26
315 0.29
316 0.26
317 0.27
318 0.25
319 0.25
320 0.25
321 0.32
322 0.35
323 0.37
324 0.44
325 0.47
326 0.5
327 0.49
328 0.48
329 0.46
330 0.44
331 0.45
332 0.41
333 0.43
334 0.42
335 0.41
336 0.37
337 0.33
338 0.32
339 0.28
340 0.23
341 0.16
342 0.1
343 0.1
344 0.1
345 0.1
346 0.1
347 0.09
348 0.1
349 0.09
350 0.09
351 0.09
352 0.08
353 0.06
354 0.06
355 0.05
356 0.04
357 0.07
358 0.08
359 0.1
360 0.1
361 0.11
362 0.11
363 0.12
364 0.16
365 0.15
366 0.19
367 0.2
368 0.21
369 0.21
370 0.22
371 0.24
372 0.23
373 0.22
374 0.17
375 0.16
376 0.16
377 0.15
378 0.14
379 0.13
380 0.12
381 0.12
382 0.14
383 0.21
384 0.21
385 0.22
386 0.29
387 0.3
388 0.35
389 0.4
390 0.44
391 0.42
392 0.48
393 0.49
394 0.49
395 0.51
396 0.48
397 0.48
398 0.48
399 0.5
400 0.52
401 0.5
402 0.51
403 0.51
404 0.58
405 0.57
406 0.53
407 0.51
408 0.49
409 0.48
410 0.42
411 0.41
412 0.34
413 0.34
414 0.37
415 0.37
416 0.4
417 0.42
418 0.43
419 0.44
420 0.45
421 0.46
422 0.5
423 0.5
424 0.43
425 0.47
426 0.5
427 0.49
428 0.47
429 0.42
430 0.35
431 0.3
432 0.31
433 0.27
434 0.29
435 0.32
436 0.39
437 0.44
438 0.44
439 0.45
440 0.42
441 0.4
442 0.33
443 0.26
444 0.19
445 0.14
446 0.11
447 0.09
448 0.11
449 0.11
450 0.11
451 0.1
452 0.09