Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4ZRX0

Protein Details
Accession E4ZRX0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-101ANKAAMQRRSHKRKRVQKEGTLHydrophilic
NLS Segment(s)
PositionSequence
85-94MQRRSHKRKR
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKLRTPSPPPVEDAPWQSQTPSNTLEFGSQSTLVKARIQRHVDSSPTSMVEAFEKKAKGAAVVAHKLVLAQKENAELRAANKAAMQRRSHKRKRVQKEGTLTVEKGLRLTTLKEFTARSDGIKALKRVRAELGEPTQRRCGRCDEAGHNGRTCKQEVECISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.4
4 0.36
5 0.36
6 0.34
7 0.32
8 0.29
9 0.24
10 0.22
11 0.22
12 0.22
13 0.19
14 0.18
15 0.17
16 0.15
17 0.15
18 0.15
19 0.17
20 0.16
21 0.2
22 0.24
23 0.27
24 0.35
25 0.39
26 0.39
27 0.43
28 0.45
29 0.43
30 0.41
31 0.37
32 0.3
33 0.26
34 0.24
35 0.19
36 0.16
37 0.16
38 0.15
39 0.14
40 0.16
41 0.16
42 0.15
43 0.17
44 0.16
45 0.14
46 0.13
47 0.16
48 0.18
49 0.19
50 0.19
51 0.18
52 0.17
53 0.17
54 0.18
55 0.15
56 0.11
57 0.1
58 0.11
59 0.14
60 0.15
61 0.15
62 0.14
63 0.12
64 0.12
65 0.15
66 0.15
67 0.11
68 0.13
69 0.16
70 0.21
71 0.26
72 0.27
73 0.32
74 0.43
75 0.53
76 0.6
77 0.65
78 0.7
79 0.75
80 0.83
81 0.85
82 0.82
83 0.79
84 0.79
85 0.76
86 0.71
87 0.63
88 0.54
89 0.44
90 0.38
91 0.3
92 0.23
93 0.17
94 0.12
95 0.11
96 0.13
97 0.15
98 0.16
99 0.17
100 0.19
101 0.19
102 0.2
103 0.24
104 0.22
105 0.19
106 0.19
107 0.2
108 0.24
109 0.29
110 0.31
111 0.32
112 0.35
113 0.35
114 0.35
115 0.37
116 0.34
117 0.31
118 0.34
119 0.36
120 0.41
121 0.42
122 0.44
123 0.49
124 0.51
125 0.5
126 0.46
127 0.46
128 0.43
129 0.47
130 0.51
131 0.47
132 0.53
133 0.59
134 0.6
135 0.56
136 0.52
137 0.51
138 0.48
139 0.44
140 0.38
141 0.33
142 0.37