Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5AAB9

Protein Details
Accession E5AAB9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-160LEETLPKTKSKRKLKMKVGGGVEHydrophilic
NLS Segment(s)
PositionSequence
146-152KSKRKLK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0001671  F:ATPase activator activity  
GO:0051117  F:ATPase binding  
GO:1902626  P:assembly of large subunit precursor of preribosome  
GO:0032781  P:positive regulation of ATP-dependent activity  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLAWTKSFRRAHGKEMTVDSTLTFAQRRNIPVRYNRDLIQTTLKAMSRVSEIRARRERAFYKTRMRGNKQRQREEDRKLVEENQHLLPPSERFAKEAVEEEEMEVDLQKVKDKVAARRKEIAAEESELDSDLEETLPKTKSKRKLKMKVGGGVEAMDVDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.71
4 0.69
5 0.68
6 0.63
7 0.57
8 0.55
9 0.52
10 0.43
11 0.39
12 0.31
13 0.24
14 0.21
15 0.18
16 0.15
17 0.13
18 0.18
19 0.22
20 0.28
21 0.32
22 0.36
23 0.41
24 0.48
25 0.55
26 0.55
27 0.54
28 0.5
29 0.5
30 0.47
31 0.42
32 0.41
33 0.33
34 0.28
35 0.29
36 0.28
37 0.22
38 0.21
39 0.2
40 0.16
41 0.17
42 0.18
43 0.21
44 0.23
45 0.31
46 0.39
47 0.42
48 0.4
49 0.47
50 0.47
51 0.48
52 0.53
53 0.5
54 0.52
55 0.55
56 0.6
57 0.62
58 0.65
59 0.68
60 0.73
61 0.75
62 0.75
63 0.76
64 0.76
65 0.76
66 0.76
67 0.72
68 0.68
69 0.62
70 0.55
71 0.47
72 0.43
73 0.38
74 0.33
75 0.3
76 0.23
77 0.21
78 0.2
79 0.19
80 0.17
81 0.14
82 0.14
83 0.17
84 0.16
85 0.16
86 0.17
87 0.17
88 0.17
89 0.19
90 0.18
91 0.15
92 0.15
93 0.14
94 0.13
95 0.12
96 0.11
97 0.08
98 0.07
99 0.07
100 0.07
101 0.1
102 0.1
103 0.1
104 0.16
105 0.2
106 0.29
107 0.37
108 0.45
109 0.47
110 0.53
111 0.54
112 0.54
113 0.52
114 0.45
115 0.38
116 0.32
117 0.29
118 0.22
119 0.22
120 0.17
121 0.15
122 0.12
123 0.1
124 0.08
125 0.06
126 0.06
127 0.07
128 0.11
129 0.13
130 0.16
131 0.22
132 0.3
133 0.41
134 0.51
135 0.61
136 0.68
137 0.77
138 0.85
139 0.88
140 0.87
141 0.85
142 0.78
143 0.7
144 0.59
145 0.49
146 0.39