Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BVH0

Protein Details
Accession Q6BVH0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
38-59IARIRRARAEKRKRLEAKARELBasic
NLS Segment(s)
PositionSequence
40-56RIRRARAEKRKRLEAKA
Subcellular Location(s) nucl 13, cyto 8, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG dha:DEHA2C02750g  -  
Amino Acid Sequences MYYVGLDSDTKFNLPGFWPDPATLNQIPKEPHEIQAEIARIRRARAEKRKRLEAKARELGIDEEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.18
4 0.2
5 0.2
6 0.2
7 0.22
8 0.22
9 0.26
10 0.23
11 0.24
12 0.23
13 0.25
14 0.25
15 0.24
16 0.3
17 0.25
18 0.27
19 0.26
20 0.25
21 0.23
22 0.26
23 0.26
24 0.2
25 0.2
26 0.19
27 0.18
28 0.18
29 0.23
30 0.26
31 0.35
32 0.45
33 0.55
34 0.62
35 0.69
36 0.79
37 0.8
38 0.82
39 0.82
40 0.8
41 0.79
42 0.77
43 0.71
44 0.61
45 0.56
46 0.48