E4ZGA4

UniProt ID: E4ZGA4   Organism: Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
Gene: LEMA_P064500.1   Protein: Similar to 60S ribosomal protein L38
Length: 108 AA

Protein Details

• Accession: E4ZGA4
• Localization Confidence: Medium
• Confidence Score: 14.1
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  21-40	SSARIKKNKKVNNIKFKVRC	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  25-29	IKKNK

• Subcellular Location(s): nucl 19, mito 4, cyto 4, cyto_mito 4
• Family & Domain DBs:
  • InterPro:
    • IPR002675 Ribosomal_L38e
    • IPR038464 Ribosomal_L38e_sf
  • Gene Ontology:
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
    • GO:0003735 F:structural constituent of ribosome
    • GO:0006412 P:translation
  • Pfam:
    • PF01781 Ribosomal_L38e
• Amino Acid Sequences: MPSEVSDIKQFIEICRRKDASSARIKKNKKVNNIKFKVRCSKNVYTLVLKDTDKAEKLKQSLPPGLAISDVGKKNPKGRHAAV

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.34
2, 0.41
3, 0.43
4, 0.39
5, 0.45
6, 0.48
7, 0.47
8, 0.53
9, 0.58
10, 0.6
11, 0.67
12, 0.7
13, 0.71
14, 0.75
15, 0.73
16, 0.72
17, 0.75
18, 0.75
19, 0.77
20, 0.8
21, 0.82
22, 0.77
23, 0.76
24, 0.76
25, 0.68
26, 0.65
27, 0.62
28, 0.6
29, 0.57
30, 0.57
31, 0.53
32, 0.45
33, 0.43
34, 0.37
35, 0.32
36, 0.27
37, 0.22
38, 0.18
39, 0.19
40, 0.18
41, 0.2
42, 0.22
43, 0.24
44, 0.27
45, 0.31
46, 0.34
47, 0.37
48, 0.39
49, 0.37
50, 0.36
51, 0.32
52, 0.29
53, 0.25
54, 0.2
55, 0.17
56, 0.2
57, 0.2
58, 0.21
59, 0.26
60, 0.3
61, 0.37
62, 0.43
63, 0.48