Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BHP3

Protein Details
Accession Q6BHP3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-62WFQNPKKRTIPNHLVPKRKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto_mito 4.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017389  Nucleoporin_NUP53  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR007846  RRM_NUP35_dom  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0005643  C:nuclear pore  
GO:0003676  F:nucleic acid binding  
GO:0017056  F:structural constituent of nuclear pore  
GO:0051028  P:mRNA transport  
GO:0015031  P:protein transport  
KEGG dha:DEHA2G17006g  -  
Pfam View protein in Pfam  
PF05172  Nup35_RRM  
PROSITE View protein in PROSITE  
PS51472  RRM_NUP35  
CDD cd12721  RRM_Nup53p_fungi  
Amino Acid Sequences MSTLFGQNSTSSGTAGNLFSQPLSSISNQTSNNNINNNNQPAWFQNPKKRTIPNHLVPKRKPGFQISSTSTSKKDSDDKKDALGSNNSSQFNLLSFGTSQRKALTSSGTIDRTNSVGSLYDTSVGDISKYEKTLNDTLTDDFPLYNNDDDLPPSRSIYDLNDEVLISLNKPANQHADAFINKDPKNFNNVFNRDDALNNNSEQTNEENLKSNPLQNGESAILIFGYPESMANQVISYFQEFGSILEEFEITKQKNTLLKHYQTNNGSNKMHQIVPILSGRSWVKITFDNPASAIDALQENGCVFNGVLLGVIPFSKDAIEKLQKRKLEEGEDIGGGFEYQLSSFDKSKKGDNTVTGESNDIQGSYITRLDIRDGSGLFLQPNSTDPTKSEADKKKEENLGFVGKIFRYFFGFNEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.15
5 0.15
6 0.14
7 0.14
8 0.14
9 0.13
10 0.16
11 0.16
12 0.19
13 0.21
14 0.28
15 0.3
16 0.31
17 0.36
18 0.38
19 0.41
20 0.43
21 0.43
22 0.42
23 0.49
24 0.52
25 0.47
26 0.42
27 0.38
28 0.36
29 0.41
30 0.44
31 0.44
32 0.49
33 0.53
34 0.59
35 0.65
36 0.7
37 0.7
38 0.71
39 0.73
40 0.73
41 0.79
42 0.79
43 0.82
44 0.76
45 0.79
46 0.74
47 0.69
48 0.64
49 0.61
50 0.61
51 0.55
52 0.6
53 0.55
54 0.57
55 0.55
56 0.53
57 0.46
58 0.42
59 0.39
60 0.36
61 0.39
62 0.41
63 0.47
64 0.53
65 0.53
66 0.52
67 0.57
68 0.55
69 0.51
70 0.48
71 0.43
72 0.41
73 0.45
74 0.42
75 0.37
76 0.35
77 0.3
78 0.24
79 0.22
80 0.15
81 0.1
82 0.1
83 0.16
84 0.21
85 0.22
86 0.22
87 0.22
88 0.23
89 0.24
90 0.24
91 0.22
92 0.19
93 0.22
94 0.27
95 0.28
96 0.27
97 0.25
98 0.25
99 0.22
100 0.2
101 0.16
102 0.11
103 0.09
104 0.1
105 0.11
106 0.11
107 0.12
108 0.11
109 0.12
110 0.12
111 0.11
112 0.1
113 0.08
114 0.11
115 0.11
116 0.12
117 0.12
118 0.13
119 0.18
120 0.22
121 0.22
122 0.22
123 0.22
124 0.22
125 0.23
126 0.22
127 0.17
128 0.13
129 0.12
130 0.12
131 0.12
132 0.11
133 0.1
134 0.1
135 0.1
136 0.12
137 0.14
138 0.15
139 0.14
140 0.14
141 0.14
142 0.14
143 0.14
144 0.15
145 0.17
146 0.14
147 0.14
148 0.14
149 0.13
150 0.13
151 0.14
152 0.11
153 0.07
154 0.1
155 0.1
156 0.12
157 0.13
158 0.14
159 0.17
160 0.18
161 0.18
162 0.17
163 0.19
164 0.18
165 0.2
166 0.21
167 0.25
168 0.24
169 0.26
170 0.27
171 0.25
172 0.32
173 0.31
174 0.34
175 0.36
176 0.39
177 0.38
178 0.36
179 0.36
180 0.29
181 0.28
182 0.24
183 0.17
184 0.15
185 0.14
186 0.14
187 0.13
188 0.12
189 0.12
190 0.13
191 0.14
192 0.14
193 0.14
194 0.16
195 0.16
196 0.2
197 0.2
198 0.2
199 0.18
200 0.19
201 0.19
202 0.15
203 0.18
204 0.14
205 0.13
206 0.11
207 0.09
208 0.07
209 0.06
210 0.06
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.08
227 0.08
228 0.08
229 0.1
230 0.09
231 0.08
232 0.07
233 0.08
234 0.07
235 0.08
236 0.13
237 0.11
238 0.12
239 0.13
240 0.16
241 0.21
242 0.22
243 0.3
244 0.33
245 0.37
246 0.43
247 0.46
248 0.49
249 0.49
250 0.56
251 0.52
252 0.5
253 0.46
254 0.4
255 0.4
256 0.36
257 0.33
258 0.25
259 0.23
260 0.17
261 0.2
262 0.21
263 0.18
264 0.15
265 0.18
266 0.18
267 0.17
268 0.18
269 0.15
270 0.15
271 0.17
272 0.18
273 0.21
274 0.22
275 0.21
276 0.21
277 0.21
278 0.2
279 0.17
280 0.16
281 0.1
282 0.09
283 0.09
284 0.08
285 0.08
286 0.06
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.04
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.05
303 0.06
304 0.07
305 0.15
306 0.25
307 0.32
308 0.41
309 0.48
310 0.5
311 0.54
312 0.59
313 0.57
314 0.54
315 0.49
316 0.45
317 0.41
318 0.38
319 0.34
320 0.27
321 0.21
322 0.15
323 0.11
324 0.07
325 0.05
326 0.04
327 0.06
328 0.09
329 0.12
330 0.16
331 0.21
332 0.27
333 0.28
334 0.36
335 0.4
336 0.44
337 0.46
338 0.48
339 0.5
340 0.49
341 0.5
342 0.44
343 0.4
344 0.33
345 0.3
346 0.25
347 0.18
348 0.14
349 0.11
350 0.12
351 0.12
352 0.13
353 0.12
354 0.13
355 0.14
356 0.16
357 0.17
358 0.18
359 0.19
360 0.18
361 0.2
362 0.2
363 0.21
364 0.19
365 0.18
366 0.16
367 0.13
368 0.15
369 0.19
370 0.19
371 0.19
372 0.19
373 0.24
374 0.27
375 0.31
376 0.39
377 0.43
378 0.49
379 0.57
380 0.61
381 0.64
382 0.69
383 0.66
384 0.61
385 0.57
386 0.55
387 0.46
388 0.43
389 0.39
390 0.31
391 0.34
392 0.31
393 0.26
394 0.25
395 0.25