Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5A7J0

Protein Details
Accession E5A7J0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-154PSPSLPVEPKRKRERRRERERERERPHPLTBasic
NLS Segment(s)
PositionSequence
133-150PKRKRERRRERERERERP
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MATMTIPPRTPSPKVHIRSQSFDSPSSRISITALEETPFSKSTGSLAMKSLPGEAAVIERETIQSTSVLVPLHTKMSAESILFDDLSAASSSPSSVAGSPTHSAPESESNMGLCTDVSPSPSPEPSPSLPVEPKRKRERRRERERERERPHPLTFAQPSHYHYHYNNNPVQPHHHKQHHKQQTPHHAASSVFLYQDPRYPMYSPFLVKVVLDLWDLRGLDWMSIAEPVQRIWGIRTCAAEVLAILCLNGRVGARRWWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.66
4 0.65
5 0.67
6 0.66
7 0.66
8 0.59
9 0.58
10 0.52
11 0.45
12 0.4
13 0.37
14 0.31
15 0.23
16 0.21
17 0.19
18 0.19
19 0.2
20 0.2
21 0.17
22 0.18
23 0.18
24 0.2
25 0.19
26 0.16
27 0.12
28 0.12
29 0.13
30 0.2
31 0.22
32 0.2
33 0.21
34 0.22
35 0.23
36 0.23
37 0.22
38 0.14
39 0.12
40 0.11
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.1
49 0.1
50 0.09
51 0.08
52 0.09
53 0.1
54 0.11
55 0.11
56 0.09
57 0.11
58 0.12
59 0.13
60 0.12
61 0.11
62 0.1
63 0.12
64 0.13
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.11
71 0.09
72 0.07
73 0.08
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.05
82 0.06
83 0.07
84 0.08
85 0.1
86 0.11
87 0.11
88 0.12
89 0.12
90 0.11
91 0.11
92 0.15
93 0.15
94 0.15
95 0.15
96 0.14
97 0.14
98 0.14
99 0.12
100 0.08
101 0.05
102 0.06
103 0.06
104 0.08
105 0.09
106 0.1
107 0.12
108 0.12
109 0.13
110 0.12
111 0.16
112 0.15
113 0.18
114 0.16
115 0.18
116 0.21
117 0.27
118 0.36
119 0.38
120 0.46
121 0.54
122 0.63
123 0.69
124 0.77
125 0.82
126 0.83
127 0.89
128 0.91
129 0.91
130 0.92
131 0.94
132 0.93
133 0.88
134 0.86
135 0.82
136 0.77
137 0.68
138 0.61
139 0.51
140 0.48
141 0.44
142 0.36
143 0.32
144 0.28
145 0.3
146 0.31
147 0.31
148 0.27
149 0.25
150 0.33
151 0.34
152 0.4
153 0.4
154 0.4
155 0.4
156 0.39
157 0.45
158 0.44
159 0.47
160 0.48
161 0.53
162 0.58
163 0.65
164 0.74
165 0.77
166 0.76
167 0.76
168 0.77
169 0.79
170 0.79
171 0.72
172 0.62
173 0.53
174 0.45
175 0.41
176 0.34
177 0.23
178 0.15
179 0.13
180 0.15
181 0.14
182 0.18
183 0.2
184 0.19
185 0.21
186 0.22
187 0.24
188 0.26
189 0.28
190 0.25
191 0.24
192 0.23
193 0.21
194 0.19
195 0.18
196 0.14
197 0.12
198 0.11
199 0.1
200 0.11
201 0.14
202 0.14
203 0.13
204 0.16
205 0.15
206 0.14
207 0.14
208 0.13
209 0.1
210 0.11
211 0.11
212 0.1
213 0.1
214 0.1
215 0.12
216 0.13
217 0.13
218 0.16
219 0.21
220 0.23
221 0.25
222 0.27
223 0.26
224 0.26
225 0.26
226 0.22
227 0.17
228 0.14
229 0.12
230 0.1
231 0.08
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.12
238 0.15