Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6H5W4

Protein Details
Accession C6H5W4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-55QGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGBasic
NLS Segment(s)
PositionSequence
12-77RERSVPQGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGEQGTPRAVPKEGRYATVRKKDR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MCRGIRERSVPRERSVPQGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGEKRPQGEQGTPRAVPKEGRYATVRKKDRRNNWLAPQDKGGEDFGFLNRLSLSTPRKPAKTQLTLRNSGSCGRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.59
4 0.56
5 0.62
6 0.65
7 0.65
8 0.67
9 0.67
10 0.65
11 0.66
12 0.7
13 0.69
14 0.7
15 0.73
16 0.76
17 0.77
18 0.8
19 0.8
20 0.77
21 0.79
22 0.77
23 0.77
24 0.8
25 0.8
26 0.77
27 0.79
28 0.77
29 0.77
30 0.8
31 0.8
32 0.77
33 0.79
34 0.77
35 0.77
36 0.8
37 0.8
38 0.74
39 0.69
40 0.65
41 0.58
42 0.55
43 0.49
44 0.44
45 0.38
46 0.34
47 0.31
48 0.27
49 0.25
50 0.22
51 0.21
52 0.25
53 0.21
54 0.24
55 0.26
56 0.31
57 0.38
58 0.46
59 0.52
60 0.51
61 0.6
62 0.67
63 0.73
64 0.77
65 0.77
66 0.76
67 0.77
68 0.78
69 0.71
70 0.63
71 0.57
72 0.49
73 0.41
74 0.35
75 0.27
76 0.18
77 0.16
78 0.15
79 0.13
80 0.13
81 0.12
82 0.12
83 0.1
84 0.1
85 0.11
86 0.16
87 0.22
88 0.27
89 0.36
90 0.42
91 0.46
92 0.49
93 0.56
94 0.6
95 0.63
96 0.65
97 0.67
98 0.69
99 0.7
100 0.7
101 0.66
102 0.58