Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HMI1

Protein Details
Accession C6HMI1   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-129GIVKWKNGQGSKRKERRKKVKTWDKAQBasic
NLS Segment(s)
PositionSequence
109-124NGQGSKRKERRKKVKT
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
Amino Acid Sequences MSSMHEIRSNAGAHNYVYEYYNSEGKIKEKVDIKVTPAASHTLTSEGQNKRAEPLQITVGDDDDGGGDDDDDDDNADVVVERQEEKKENNNEQKVLNKILEYGIVKWKNGQGSKRKERRKKVKTWDKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.17
5 0.16
6 0.16
7 0.16
8 0.19
9 0.18
10 0.19
11 0.19
12 0.2
13 0.26
14 0.24
15 0.27
16 0.29
17 0.32
18 0.36
19 0.36
20 0.37
21 0.37
22 0.37
23 0.32
24 0.28
25 0.27
26 0.21
27 0.2
28 0.17
29 0.13
30 0.14
31 0.15
32 0.22
33 0.21
34 0.25
35 0.27
36 0.26
37 0.26
38 0.28
39 0.27
40 0.2
41 0.2
42 0.19
43 0.17
44 0.18
45 0.16
46 0.13
47 0.12
48 0.11
49 0.09
50 0.05
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.04
67 0.05
68 0.06
69 0.08
70 0.11
71 0.13
72 0.17
73 0.25
74 0.32
75 0.41
76 0.49
77 0.52
78 0.52
79 0.52
80 0.54
81 0.49
82 0.45
83 0.37
84 0.27
85 0.24
86 0.22
87 0.24
88 0.2
89 0.19
90 0.25
91 0.26
92 0.26
93 0.27
94 0.3
95 0.34
96 0.38
97 0.44
98 0.44
99 0.53
100 0.65
101 0.72
102 0.8
103 0.83
104 0.89
105 0.92
106 0.92
107 0.92
108 0.92
109 0.93