Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HB58

Protein Details
Accession C6HB58    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-95FTDNSNKKNKRGKDKNKKKNFKSEKKNNKTQICFYCHydrophilic
NLS Segment(s)
PositionSequence
66-86KKNKRGKDKNKKKNFKSEKKN
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKASRVNTISVSDKNFSLDLIEYLQQMSRTSALVKLLDEFRDQVRLIKKVKDFIFFDCLFTDNSNKKNKRGKDKNKKKNFKSEKKNNKTQICFYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.22
4 0.18
5 0.15
6 0.12
7 0.13
8 0.13
9 0.11
10 0.12
11 0.13
12 0.12
13 0.12
14 0.12
15 0.1
16 0.1
17 0.11
18 0.12
19 0.12
20 0.12
21 0.12
22 0.13
23 0.14
24 0.14
25 0.14
26 0.14
27 0.12
28 0.15
29 0.14
30 0.17
31 0.19
32 0.23
33 0.24
34 0.28
35 0.29
36 0.33
37 0.34
38 0.34
39 0.32
40 0.3
41 0.35
42 0.29
43 0.29
44 0.23
45 0.23
46 0.18
47 0.18
48 0.22
49 0.19
50 0.25
51 0.34
52 0.36
53 0.43
54 0.52
55 0.59
56 0.64
57 0.71
58 0.77
59 0.78
60 0.87
61 0.9
62 0.93
63 0.96
64 0.92
65 0.92
66 0.92
67 0.91
68 0.91
69 0.92
70 0.92
71 0.91
72 0.94
73 0.92
74 0.91
75 0.87