Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W0FKE2

Protein Details
Accession A0A0W0FKE2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27TSSVNAKKKAKPSATNEKKPHAHydrophilic
NLS Segment(s)
PositionSequence
12-16KKKAK
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 10.5, cyto_nucl 8.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MGKKGTSSVNAKKKAKPSATNEKKPHAVWSEADEENLLEGLVECQSRISEGGNFRLVVFNEVAKTLNPPASGGDKMGKGCKDKYGTIKHDWEEVIKINHKSGWPPWDWQLGANITPKHENNWNEYVKANSRAASFRNKSYKYQKYFDVLMPLDTTLPKQLNICRIGRKKAEAQDSDEEDDGGKSMSDGAEESVRNAGEVEEVAGEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.74
4 0.73
5 0.75
6 0.8
7 0.83
8 0.81
9 0.78
10 0.75
11 0.66
12 0.65
13 0.58
14 0.5
15 0.42
16 0.4
17 0.39
18 0.34
19 0.33
20 0.26
21 0.21
22 0.18
23 0.16
24 0.11
25 0.05
26 0.05
27 0.05
28 0.07
29 0.07
30 0.06
31 0.07
32 0.07
33 0.08
34 0.08
35 0.09
36 0.12
37 0.15
38 0.19
39 0.2
40 0.21
41 0.2
42 0.23
43 0.22
44 0.19
45 0.17
46 0.15
47 0.13
48 0.13
49 0.13
50 0.1
51 0.12
52 0.12
53 0.13
54 0.12
55 0.12
56 0.14
57 0.16
58 0.16
59 0.15
60 0.16
61 0.15
62 0.17
63 0.2
64 0.21
65 0.21
66 0.21
67 0.26
68 0.26
69 0.28
70 0.35
71 0.4
72 0.42
73 0.45
74 0.48
75 0.43
76 0.42
77 0.39
78 0.32
79 0.25
80 0.22
81 0.2
82 0.2
83 0.2
84 0.17
85 0.19
86 0.18
87 0.19
88 0.19
89 0.21
90 0.18
91 0.19
92 0.21
93 0.23
94 0.22
95 0.21
96 0.21
97 0.17
98 0.18
99 0.2
100 0.18
101 0.16
102 0.19
103 0.19
104 0.18
105 0.24
106 0.23
107 0.25
108 0.32
109 0.32
110 0.3
111 0.3
112 0.31
113 0.28
114 0.3
115 0.26
116 0.2
117 0.21
118 0.22
119 0.24
120 0.3
121 0.3
122 0.33
123 0.41
124 0.42
125 0.47
126 0.55
127 0.63
128 0.59
129 0.59
130 0.56
131 0.51
132 0.52
133 0.46
134 0.43
135 0.34
136 0.29
137 0.26
138 0.23
139 0.19
140 0.17
141 0.16
142 0.13
143 0.14
144 0.14
145 0.16
146 0.2
147 0.26
148 0.3
149 0.34
150 0.39
151 0.44
152 0.51
153 0.52
154 0.54
155 0.54
156 0.57
157 0.62
158 0.55
159 0.56
160 0.55
161 0.55
162 0.52
163 0.45
164 0.37
165 0.29
166 0.26
167 0.2
168 0.13
169 0.09
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.09
176 0.13
177 0.13
178 0.14
179 0.16
180 0.16
181 0.16
182 0.15
183 0.13
184 0.1
185 0.1
186 0.1
187 0.08