Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZKR1

Protein Details
Accession A0A2P4ZKR1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
414-436KITKSAKSSAKKKKMGWHRYYCLHydrophilic
NLS Segment(s)
PositionSequence
420-427KSSAKKKK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR013126  Hsp_70_fam  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00012  HSP70  
Amino Acid Sequences MCNRRLDEPSETKTEGESAQELTRIYLSCLYSHFISVLEGKLSPSVVQSTPMDVVVTVPAIWSNSAKQETEKAASLAGFGGEQKIKLISEPEAAALYTVKYLSPSVLQTGRKFVVCDAGGGTVDLITYEVAKVQPLQMREVTEGTGGKCGSSMLNMRFRRYLKQIHGDKYWTDERLVVALSEFEAFKRDFSPKGEPLTLKVDPSLGLKRDRFTISQDDMATKIWDPIMKDIICLIKEQISMADEKVAAVVLVGGFGQNAYLRSRVREVIASRVRVLQPENGVTAVVKGAVIYGLGNYQPAMALVGIASRVARRSYGTCLLTKYDPTKHNRDEAFWSEKEEGWVVVEMCWFIRKGQSYPDDKPSKIEYQCDIPVFMGHKPQADIEIFSNDDDLDAPIHVSGTTKRVATLFLDLHKITKSAKSSAKKKKMGWHRYYCLTGVIEANYGSAMITYTLKLGGLYILRSSSKHSFELQIGSNINTGVTHDVIRVRYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.31
3 0.27
4 0.23
5 0.2
6 0.2
7 0.21
8 0.21
9 0.19
10 0.21
11 0.18
12 0.19
13 0.21
14 0.2
15 0.2
16 0.21
17 0.24
18 0.21
19 0.22
20 0.2
21 0.15
22 0.16
23 0.16
24 0.16
25 0.14
26 0.14
27 0.14
28 0.15
29 0.15
30 0.14
31 0.13
32 0.16
33 0.14
34 0.18
35 0.18
36 0.2
37 0.2
38 0.2
39 0.18
40 0.14
41 0.14
42 0.12
43 0.11
44 0.08
45 0.07
46 0.08
47 0.08
48 0.09
49 0.1
50 0.11
51 0.17
52 0.2
53 0.21
54 0.22
55 0.27
56 0.3
57 0.32
58 0.32
59 0.26
60 0.24
61 0.23
62 0.22
63 0.17
64 0.12
65 0.09
66 0.08
67 0.12
68 0.11
69 0.11
70 0.12
71 0.13
72 0.12
73 0.13
74 0.15
75 0.13
76 0.15
77 0.16
78 0.16
79 0.15
80 0.15
81 0.14
82 0.12
83 0.1
84 0.08
85 0.08
86 0.07
87 0.08
88 0.08
89 0.09
90 0.11
91 0.11
92 0.15
93 0.21
94 0.25
95 0.25
96 0.31
97 0.32
98 0.3
99 0.3
100 0.26
101 0.28
102 0.24
103 0.23
104 0.18
105 0.17
106 0.16
107 0.15
108 0.15
109 0.07
110 0.07
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.06
117 0.06
118 0.07
119 0.07
120 0.11
121 0.14
122 0.15
123 0.19
124 0.19
125 0.21
126 0.22
127 0.23
128 0.19
129 0.18
130 0.18
131 0.15
132 0.17
133 0.15
134 0.13
135 0.12
136 0.12
137 0.1
138 0.11
139 0.16
140 0.18
141 0.27
142 0.29
143 0.31
144 0.36
145 0.38
146 0.41
147 0.41
148 0.44
149 0.42
150 0.5
151 0.55
152 0.54
153 0.56
154 0.53
155 0.47
156 0.45
157 0.41
158 0.33
159 0.26
160 0.22
161 0.19
162 0.18
163 0.18
164 0.12
165 0.08
166 0.07
167 0.07
168 0.07
169 0.06
170 0.05
171 0.08
172 0.08
173 0.08
174 0.11
175 0.13
176 0.14
177 0.18
178 0.25
179 0.26
180 0.3
181 0.32
182 0.3
183 0.31
184 0.35
185 0.32
186 0.25
187 0.22
188 0.18
189 0.16
190 0.18
191 0.2
192 0.16
193 0.21
194 0.22
195 0.22
196 0.26
197 0.27
198 0.25
199 0.25
200 0.29
201 0.26
202 0.28
203 0.27
204 0.24
205 0.23
206 0.22
207 0.19
208 0.13
209 0.11
210 0.09
211 0.1
212 0.1
213 0.11
214 0.16
215 0.15
216 0.15
217 0.15
218 0.17
219 0.15
220 0.15
221 0.14
222 0.11
223 0.11
224 0.11
225 0.1
226 0.09
227 0.09
228 0.09
229 0.09
230 0.07
231 0.06
232 0.06
233 0.05
234 0.05
235 0.04
236 0.04
237 0.02
238 0.03
239 0.03
240 0.02
241 0.02
242 0.02
243 0.03
244 0.03
245 0.04
246 0.05
247 0.08
248 0.09
249 0.11
250 0.13
251 0.14
252 0.14
253 0.18
254 0.18
255 0.25
256 0.29
257 0.28
258 0.27
259 0.3
260 0.29
261 0.26
262 0.27
263 0.2
264 0.18
265 0.18
266 0.17
267 0.14
268 0.13
269 0.12
270 0.1
271 0.07
272 0.05
273 0.04
274 0.03
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.03
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.06
297 0.06
298 0.07
299 0.09
300 0.11
301 0.16
302 0.23
303 0.24
304 0.25
305 0.26
306 0.28
307 0.27
308 0.28
309 0.28
310 0.29
311 0.33
312 0.38
313 0.45
314 0.45
315 0.51
316 0.49
317 0.48
318 0.47
319 0.46
320 0.46
321 0.38
322 0.38
323 0.33
324 0.32
325 0.31
326 0.25
327 0.19
328 0.14
329 0.15
330 0.11
331 0.1
332 0.1
333 0.09
334 0.08
335 0.1
336 0.09
337 0.08
338 0.12
339 0.14
340 0.15
341 0.23
342 0.31
343 0.36
344 0.4
345 0.49
346 0.5
347 0.47
348 0.5
349 0.48
350 0.48
351 0.44
352 0.43
353 0.36
354 0.36
355 0.4
356 0.37
357 0.32
358 0.25
359 0.25
360 0.23
361 0.22
362 0.22
363 0.2
364 0.2
365 0.21
366 0.21
367 0.22
368 0.21
369 0.21
370 0.17
371 0.19
372 0.18
373 0.17
374 0.17
375 0.13
376 0.12
377 0.11
378 0.09
379 0.07
380 0.07
381 0.07
382 0.06
383 0.07
384 0.07
385 0.08
386 0.09
387 0.11
388 0.14
389 0.14
390 0.15
391 0.15
392 0.17
393 0.17
394 0.21
395 0.2
396 0.2
397 0.25
398 0.24
399 0.25
400 0.25
401 0.24
402 0.21
403 0.24
404 0.25
405 0.28
406 0.37
407 0.45
408 0.55
409 0.65
410 0.73
411 0.75
412 0.77
413 0.8
414 0.82
415 0.84
416 0.84
417 0.83
418 0.79
419 0.77
420 0.74
421 0.65
422 0.58
423 0.48
424 0.39
425 0.31
426 0.25
427 0.2
428 0.17
429 0.16
430 0.12
431 0.11
432 0.09
433 0.06
434 0.06
435 0.06
436 0.07
437 0.07
438 0.08
439 0.09
440 0.09
441 0.09
442 0.09
443 0.1
444 0.11
445 0.12
446 0.12
447 0.15
448 0.16
449 0.17
450 0.23
451 0.27
452 0.3
453 0.31
454 0.33
455 0.34
456 0.36
457 0.41
458 0.38
459 0.36
460 0.34
461 0.33
462 0.31
463 0.26
464 0.23
465 0.18
466 0.16
467 0.14
468 0.13
469 0.13
470 0.15
471 0.19