FuNGI

A0A2P4Z807

Protein Details

Accession

A0A2P4Z807

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
523-556	FGMGPHKHKKPFVQSKGRKFERARGRRRSRGFKV	Basic

NLS Segment(s)

Position	Sequence
519-556	AVKHFGMGPHKHKKPFVQSKGRKFERARGRRRSRGFKV

Subcellular Location(s)

plas 19, extr 5, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036227 L18e/L15P_sf IPR021149 OligosaccharylTrfase_OST3/OST6 IPR021132 Ribosomal_L18/L18-A/B/e_CS IPR000039 Ribosomal_L18e IPR021131 Ribosomal_L18e/L15P
Gene Ontology	GO:0005737 C:cytoplasm GO:0016020 C:membrane GO:1990904 C:ribonucleoprotein complex GO:0005840 C:ribosome GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF04756 OST3_OST6 PF17135 Ribosomal_L18
PROSITE	View protein in PROSITE PS01106 RIBOSOMAL_L18E

Amino Acid Sequences

MRIFQSILPLCLLFAGGFAKKDSYDEFRQLSQRSSPLKLNDATYSSLTAAPRNHSVAVLLTALETRFGCQLCQEFAPEWEVLGRSWTRGDKAGESRLIFGTLDFADGRETFISLGLQTAPVLLLFNPTIGPHAAASPEPVRYDFTAGPSAAEQVHSWISRQLPNRPHPPVQRPFNWLRWASTVTIVLGVGTALASASAYVLPVIQNRNIWASISLIAILLFISGHMFNHIRKVPYIVGDGHGGVSYIAGGFQNQLGLETQIVAAIYGVLSFCAITLAVKVPRMADAKTQQVAVVVWSVILFLVYSFLLSVFRVKNSGYPFSLPPFIPTAGQSEHQSRSKALKFLVGKFGCIPRHFRLRLSSPSSSFSAPVVAMGIDLDRHHVKGTHRKAPKSDNVYLKLLVKLYRFLARRTDAAFNKVILRRLFMSKINRPPVSLSRIVSNINKEGEKRTVVIVGTVTDDNRLLSFPKATIAALRFTATARARIAAAGGEAITLDQLALRAPTGSNTLILRGPKNSREAVKHFGMGPHKHKKPFVQSKGRKFERARGRRRSRGFKV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.09
2	0.12
3	0.12
4	0.13
5	0.14
6	0.16
7	0.15
8	0.18
9	0.21
10	0.25
11	0.29
12	0.35
13	0.37
14	0.4
15	0.47
16	0.47
17	0.47
18	0.45
19	0.47
20	0.45
21	0.46
22	0.48
23	0.45
24	0.49
25	0.48
26	0.46
27	0.42
28	0.39
29	0.38
30	0.32
31	0.3
32	0.25
33	0.26
34	0.23
35	0.24
36	0.25
37	0.26
38	0.29
39	0.3
40	0.29
41	0.25
42	0.25
43	0.22
44	0.21
45	0.17
46	0.13
47	0.11
48	0.11
49	0.11
50	0.12
51	0.11
52	0.1
53	0.13
54	0.14
55	0.14
56	0.16
57	0.19
58	0.2
59	0.21
60	0.22
61	0.19
62	0.2
63	0.23
64	0.2
65	0.17
66	0.16
67	0.15
68	0.13
69	0.17
70	0.16
71	0.14
72	0.18
73	0.21
74	0.21
75	0.25
76	0.28
77	0.3
78	0.35
79	0.4
80	0.41
81	0.4
82	0.4
83	0.36
84	0.34
85	0.27
86	0.21
87	0.18
88	0.13
89	0.14
90	0.11
91	0.1
92	0.12
93	0.12
94	0.13
95	0.11
96	0.11
97	0.09
98	0.1
99	0.1
100	0.08
101	0.09
102	0.07
103	0.07
104	0.07
105	0.07
106	0.06
107	0.06
108	0.06
109	0.05
110	0.08
111	0.07
112	0.08
113	0.08
114	0.08
115	0.1
116	0.09
117	0.1
118	0.08
119	0.09
120	0.1
121	0.1
122	0.13
123	0.13
124	0.15
125	0.15
126	0.15
127	0.17
128	0.17
129	0.21
130	0.18
131	0.2
132	0.22
133	0.21
134	0.21
135	0.18
136	0.19
137	0.15
138	0.15
139	0.11
140	0.1
141	0.13
142	0.13
143	0.13
144	0.15
145	0.18
146	0.23
147	0.27
148	0.32
149	0.38
150	0.45
151	0.53
152	0.56
153	0.6
154	0.62
155	0.68
156	0.69
157	0.68
158	0.65
159	0.64
160	0.63
161	0.62
162	0.61
163	0.52
164	0.46
165	0.42
166	0.39
167	0.33
168	0.3
169	0.24
170	0.17
171	0.16
172	0.14
173	0.1
174	0.08
175	0.06
176	0.04
177	0.03
178	0.03
179	0.02
180	0.02
181	0.02
182	0.02
183	0.03
184	0.03
185	0.03
186	0.03
187	0.04
188	0.04
189	0.07
190	0.1
191	0.11
192	0.12
193	0.13
194	0.15
195	0.14
196	0.14
197	0.12
198	0.11
199	0.11
200	0.1
201	0.09
202	0.07
203	0.07
204	0.06
205	0.06
206	0.04
207	0.03
208	0.03
209	0.04
210	0.04
211	0.04
212	0.06
213	0.07
214	0.08
215	0.14
216	0.17
217	0.17
218	0.17
219	0.2
220	0.19
221	0.2
222	0.22
223	0.17
224	0.15
225	0.15
226	0.15
227	0.12
228	0.1
229	0.09
230	0.06
231	0.05
232	0.04
233	0.03
234	0.03
235	0.03
236	0.03
237	0.03
238	0.04
239	0.04
240	0.04
241	0.05
242	0.05
243	0.05
244	0.05
245	0.05
246	0.05
247	0.05
248	0.05
249	0.04
250	0.04
251	0.03
252	0.03
253	0.03
254	0.03
255	0.02
256	0.02
257	0.02
258	0.02
259	0.03
260	0.03
261	0.03
262	0.03
263	0.06
264	0.07
265	0.08
266	0.08
267	0.08
268	0.12
269	0.13
270	0.13
271	0.16
272	0.18
273	0.21
274	0.21
275	0.21
276	0.18
277	0.17
278	0.16
279	0.12
280	0.1
281	0.06
282	0.05
283	0.05
284	0.05
285	0.04
286	0.04
287	0.03
288	0.02
289	0.03
290	0.03
291	0.03
292	0.03
293	0.04
294	0.04
295	0.04
296	0.08
297	0.08
298	0.08
299	0.1
300	0.1
301	0.14
302	0.17
303	0.2
304	0.17
305	0.19
306	0.2
307	0.21
308	0.24
309	0.2
310	0.18
311	0.18
312	0.17
313	0.15
314	0.15
315	0.16
316	0.14
317	0.16
318	0.16
319	0.18
320	0.22
321	0.24
322	0.25
323	0.23
324	0.29
325	0.31
326	0.31
327	0.27
328	0.3
329	0.31
330	0.33
331	0.41
332	0.34
333	0.31
334	0.31
335	0.36
336	0.33
337	0.31
338	0.34
339	0.29
340	0.38
341	0.38
342	0.38
343	0.39
344	0.41
345	0.47
346	0.48
347	0.47
348	0.39
349	0.41
350	0.41
351	0.35
352	0.3
353	0.23
354	0.17
355	0.13
356	0.12
357	0.09
358	0.07
359	0.06
360	0.05
361	0.05
362	0.05
363	0.05
364	0.08
365	0.09
366	0.09
367	0.1
368	0.14
369	0.19
370	0.29
371	0.37
372	0.42
373	0.48
374	0.52
375	0.57
376	0.62
377	0.65
378	0.62
379	0.62
380	0.61
381	0.59
382	0.57
383	0.54
384	0.47
385	0.4
386	0.34
387	0.3
388	0.23
389	0.21
390	0.21
391	0.27
392	0.26
393	0.26
394	0.31
395	0.31
396	0.33
397	0.34
398	0.4
399	0.35
400	0.38
401	0.37
402	0.31
403	0.36
404	0.36
405	0.38
406	0.3
407	0.31
408	0.29
409	0.32
410	0.34
411	0.33
412	0.39
413	0.42
414	0.51
415	0.56
416	0.54
417	0.51
418	0.53
419	0.53
420	0.51
421	0.47
422	0.39
423	0.34
424	0.36
425	0.38
426	0.36
427	0.34
428	0.32
429	0.31
430	0.32
431	0.3
432	0.32
433	0.33
434	0.31
435	0.28
436	0.25
437	0.25
438	0.23
439	0.22
440	0.18
441	0.15
442	0.16
443	0.15
444	0.14
445	0.12
446	0.12
447	0.12
448	0.11
449	0.11
450	0.1
451	0.11
452	0.13
453	0.12
454	0.14
455	0.14
456	0.14
457	0.18
458	0.18
459	0.19
460	0.18
461	0.19
462	0.18
463	0.17
464	0.25
465	0.21
466	0.24
467	0.22
468	0.22
469	0.22
470	0.21
471	0.21
472	0.14
473	0.13
474	0.09
475	0.08
476	0.07
477	0.06
478	0.06
479	0.05
480	0.04
481	0.04
482	0.04
483	0.04
484	0.05
485	0.05
486	0.06
487	0.07
488	0.07
489	0.09
490	0.12
491	0.13
492	0.15
493	0.15
494	0.17
495	0.2
496	0.23
497	0.25
498	0.28
499	0.34
500	0.36
501	0.41
502	0.44
503	0.47
504	0.52
505	0.54
506	0.55
507	0.52
508	0.5
509	0.47
510	0.47
511	0.49
512	0.5
513	0.53
514	0.57
515	0.61
516	0.65
517	0.68
518	0.71
519	0.74
520	0.77
521	0.78
522	0.79
523	0.82
524	0.86
525	0.92
526	0.89
527	0.87
528	0.8
529	0.8
530	0.8
531	0.8
532	0.8
533	0.8
534	0.84
535	0.85
536	0.91

A0A2P4Z807

3D AlphaFold-predicted Structure Viewer