Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H5E0

Protein Details
Accession C6H5E0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-92YICPAPLPRRRRKDHRVRTHRESVDBasic
NLS Segment(s)
PositionSequence
76-83RRRRKDHR
Subcellular Location(s) cysk 11, nucl 9, cyto 3, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
Amino Acid Sequences MPTDGTFIFSMEFSTLSCFRLEYITLVGNETMIKSSGRGETIIRKSVWLGQVNHHGSLMLDREFGGKYICPAPLPRRRRKDHRVRTHRESVDGFGFRRVCTDVLAVAEEHREQLKSREKKVNKMEQSGLTEEELLRQQQELFRCAGEKYNAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.13
6 0.13
7 0.15
8 0.15
9 0.12
10 0.14
11 0.16
12 0.16
13 0.17
14 0.16
15 0.14
16 0.14
17 0.12
18 0.11
19 0.08
20 0.08
21 0.08
22 0.1
23 0.12
24 0.12
25 0.13
26 0.14
27 0.22
28 0.27
29 0.31
30 0.28
31 0.27
32 0.27
33 0.31
34 0.34
35 0.31
36 0.28
37 0.27
38 0.36
39 0.38
40 0.37
41 0.32
42 0.26
43 0.2
44 0.21
45 0.19
46 0.1
47 0.08
48 0.08
49 0.09
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.1
56 0.1
57 0.09
58 0.12
59 0.2
60 0.29
61 0.38
62 0.46
63 0.53
64 0.6
65 0.69
66 0.77
67 0.8
68 0.81
69 0.84
70 0.86
71 0.85
72 0.85
73 0.85
74 0.76
75 0.68
76 0.58
77 0.49
78 0.43
79 0.37
80 0.29
81 0.24
82 0.24
83 0.2
84 0.21
85 0.19
86 0.15
87 0.14
88 0.14
89 0.1
90 0.1
91 0.11
92 0.1
93 0.09
94 0.1
95 0.09
96 0.09
97 0.1
98 0.1
99 0.1
100 0.18
101 0.28
102 0.33
103 0.41
104 0.5
105 0.53
106 0.62
107 0.71
108 0.74
109 0.7
110 0.7
111 0.67
112 0.62
113 0.62
114 0.55
115 0.46
116 0.36
117 0.31
118 0.25
119 0.23
120 0.2
121 0.16
122 0.15
123 0.14
124 0.15
125 0.18
126 0.22
127 0.21
128 0.2
129 0.2
130 0.21
131 0.22
132 0.26
133 0.25