Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZRL1

Protein Details
Accession A0A2P4ZRL1   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
117-137GGVRKEKKSEYRQYMNRQGGFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSEHGGAANYRDDRRRSASPPSHPSALPTRPHPETISRKPQSDATRSPSPRRDRDRDSNRKNAPPSPSKMDQDEYDEDIEVEGQGDDDDGLASMQALMGFGGFGTTKGKKVAGNNAGGVRKEKKSEYRQYMNRQGGFNRPLSPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.45
4 0.52
5 0.56
6 0.59
7 0.64
8 0.64
9 0.61
10 0.55
11 0.55
12 0.52
13 0.5
14 0.44
15 0.42
16 0.43
17 0.42
18 0.44
19 0.42
20 0.44
21 0.47
22 0.52
23 0.57
24 0.54
25 0.54
26 0.53
27 0.58
28 0.55
29 0.53
30 0.49
31 0.45
32 0.51
33 0.53
34 0.58
35 0.6
36 0.61
37 0.63
38 0.66
39 0.66
40 0.65
41 0.72
42 0.77
43 0.79
44 0.78
45 0.79
46 0.76
47 0.75
48 0.7
49 0.64
50 0.59
51 0.54
52 0.52
53 0.49
54 0.47
55 0.43
56 0.42
57 0.39
58 0.32
59 0.31
60 0.28
61 0.23
62 0.19
63 0.17
64 0.15
65 0.13
66 0.12
67 0.07
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.02
88 0.03
89 0.03
90 0.04
91 0.08
92 0.09
93 0.11
94 0.12
95 0.14
96 0.17
97 0.21
98 0.31
99 0.32
100 0.34
101 0.36
102 0.4
103 0.41
104 0.39
105 0.4
106 0.35
107 0.33
108 0.34
109 0.37
110 0.41
111 0.48
112 0.58
113 0.63
114 0.68
115 0.74
116 0.8
117 0.84
118 0.83
119 0.78
120 0.71
121 0.64
122 0.63
123 0.58
124 0.52
125 0.46