Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZFH3

Protein Details
Accession A0A2P4ZFH3   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-212LDCFHSPDERKPPRCDRPQIGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5cyto_mito 8.5, mito 7.5, nucl 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006913  CENP-V/GFA  
IPR011057  Mss4-like_sf  
Gene Ontology GO:0016846  F:carbon-sulfur lyase activity  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS51891  CENP_V_GFA  
Amino Acid Sequences MSQLADDQPRRLPYTGSCHCGNIRYVVFLTLPPASLIGLSKPPPSRGVQRIYRCNCTVCHKSGFLHVRPASAFDDFLLLSPLNPLDSLGDYLCNKQTLHNLFCKTCAVRCFTIHGEGEVVETSLPRAIALPSTSSSEDEAVSVNAWRLKPVELTEGIPHQGSYLSVNGHTIDPGQEGLDLREWVSTKAIGYLDCFHSPDERKPPRCDRPQIGGSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.44
4 0.41
5 0.41
6 0.42
7 0.43
8 0.38
9 0.34
10 0.29
11 0.27
12 0.26
13 0.24
14 0.23
15 0.19
16 0.2
17 0.15
18 0.14
19 0.11
20 0.11
21 0.09
22 0.09
23 0.1
24 0.09
25 0.13
26 0.15
27 0.2
28 0.22
29 0.24
30 0.27
31 0.3
32 0.36
33 0.39
34 0.45
35 0.48
36 0.55
37 0.63
38 0.65
39 0.67
40 0.61
41 0.56
42 0.51
43 0.5
44 0.48
45 0.41
46 0.4
47 0.35
48 0.34
49 0.41
50 0.45
51 0.39
52 0.42
53 0.38
54 0.36
55 0.34
56 0.36
57 0.29
58 0.23
59 0.21
60 0.12
61 0.13
62 0.11
63 0.11
64 0.1
65 0.08
66 0.07
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.05
73 0.06
74 0.07
75 0.06
76 0.09
77 0.09
78 0.11
79 0.12
80 0.12
81 0.12
82 0.12
83 0.19
84 0.21
85 0.23
86 0.28
87 0.29
88 0.28
89 0.29
90 0.3
91 0.24
92 0.22
93 0.21
94 0.2
95 0.19
96 0.19
97 0.21
98 0.2
99 0.23
100 0.21
101 0.19
102 0.15
103 0.14
104 0.13
105 0.1
106 0.09
107 0.05
108 0.04
109 0.04
110 0.05
111 0.05
112 0.04
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.08
119 0.11
120 0.12
121 0.12
122 0.13
123 0.12
124 0.12
125 0.1
126 0.1
127 0.08
128 0.07
129 0.07
130 0.08
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.14
137 0.15
138 0.18
139 0.16
140 0.18
141 0.19
142 0.2
143 0.2
144 0.18
145 0.16
146 0.12
147 0.11
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.11
154 0.12
155 0.12
156 0.11
157 0.1
158 0.09
159 0.09
160 0.1
161 0.09
162 0.09
163 0.1
164 0.11
165 0.13
166 0.13
167 0.12
168 0.15
169 0.15
170 0.15
171 0.16
172 0.15
173 0.13
174 0.16
175 0.16
176 0.14
177 0.16
178 0.19
179 0.22
180 0.23
181 0.24
182 0.21
183 0.28
184 0.32
185 0.37
186 0.44
187 0.5
188 0.55
189 0.63
190 0.73
191 0.76
192 0.82
193 0.83
194 0.8
195 0.79