Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZKN6

Protein Details
Accession A0A2P4ZKN6    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-107SDPRPSKPKSKPFTNLKHIKRBasic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, extr 7, nucl 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045865  ACT-like_dom_sf  
IPR002912  ACT_dom  
IPR008242  Chor_mutase/pphenate_deHydtase  
IPR001086  Preph_deHydtase  
Gene Ontology GO:0004106  F:chorismate mutase activity  
GO:0004664  F:prephenate dehydratase activity  
GO:0009094  P:L-phenylalanine biosynthetic process  
Pfam View protein in Pfam  
PF00800  PDT  
PROSITE View protein in PROSITE  
PS51671  ACT  
PS51171  PREPHENATE_DEHYDR_3  
CDD cd04905  ACT_CM-PDT  
cd13532  PBP2_PDT_like  
Amino Acid Sequences MASSGKPVVQFGEVKAGVVPIENSTNGSVVFTLDNLADRNGRYKDITVDGEIFVDVHHCLVGHKNPSPLLDLDDHGDGSGTCTPTLSDPRPSKPKSKPFTNLKHIKRLYSHPQAFGQCNAFISSYLKGVEIFDVSSTSKAAEIVSQDTTGTWAAISSELAANLMEGLDMLAKSIEDRDDNTTRFLIIGKNTPVPKDWGLVNQSVGKASTRTLISFTVPHTSPGALAEVLGGFKAYDLNLTSINSRPSLLAPFQYIFFIEFEGNKYDDPDGRVKGALDTIDRAAENWRLLGSWERYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.18
5 0.17
6 0.17
7 0.1
8 0.13
9 0.12
10 0.14
11 0.14
12 0.15
13 0.14
14 0.13
15 0.11
16 0.1
17 0.1
18 0.08
19 0.09
20 0.08
21 0.1
22 0.1
23 0.12
24 0.13
25 0.13
26 0.2
27 0.2
28 0.23
29 0.23
30 0.24
31 0.26
32 0.29
33 0.3
34 0.26
35 0.26
36 0.24
37 0.22
38 0.2
39 0.16
40 0.11
41 0.1
42 0.08
43 0.06
44 0.06
45 0.05
46 0.06
47 0.12
48 0.17
49 0.22
50 0.24
51 0.27
52 0.28
53 0.3
54 0.32
55 0.27
56 0.25
57 0.21
58 0.19
59 0.18
60 0.18
61 0.16
62 0.13
63 0.13
64 0.09
65 0.1
66 0.13
67 0.11
68 0.1
69 0.11
70 0.11
71 0.14
72 0.2
73 0.2
74 0.26
75 0.29
76 0.37
77 0.46
78 0.49
79 0.55
80 0.59
81 0.67
82 0.65
83 0.7
84 0.72
85 0.73
86 0.79
87 0.8
88 0.81
89 0.75
90 0.78
91 0.7
92 0.65
93 0.58
94 0.56
95 0.54
96 0.55
97 0.53
98 0.45
99 0.48
100 0.48
101 0.46
102 0.41
103 0.34
104 0.24
105 0.21
106 0.2
107 0.15
108 0.13
109 0.13
110 0.11
111 0.1
112 0.1
113 0.09
114 0.09
115 0.09
116 0.09
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.08
131 0.09
132 0.09
133 0.08
134 0.08
135 0.09
136 0.08
137 0.07
138 0.05
139 0.04
140 0.04
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.03
152 0.02
153 0.02
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.05
163 0.07
164 0.13
165 0.17
166 0.18
167 0.2
168 0.19
169 0.18
170 0.18
171 0.17
172 0.14
173 0.12
174 0.16
175 0.17
176 0.22
177 0.23
178 0.23
179 0.24
180 0.25
181 0.24
182 0.21
183 0.2
184 0.2
185 0.22
186 0.22
187 0.23
188 0.21
189 0.21
190 0.19
191 0.19
192 0.15
193 0.13
194 0.12
195 0.14
196 0.13
197 0.13
198 0.14
199 0.15
200 0.15
201 0.16
202 0.17
203 0.19
204 0.18
205 0.19
206 0.18
207 0.17
208 0.16
209 0.15
210 0.15
211 0.1
212 0.09
213 0.08
214 0.07
215 0.07
216 0.07
217 0.06
218 0.04
219 0.04
220 0.05
221 0.05
222 0.06
223 0.07
224 0.09
225 0.1
226 0.12
227 0.14
228 0.16
229 0.18
230 0.17
231 0.16
232 0.16
233 0.16
234 0.2
235 0.2
236 0.19
237 0.2
238 0.2
239 0.2
240 0.2
241 0.19
242 0.16
243 0.14
244 0.14
245 0.11
246 0.11
247 0.13
248 0.16
249 0.17
250 0.15
251 0.17
252 0.18
253 0.2
254 0.23
255 0.27
256 0.26
257 0.27
258 0.28
259 0.27
260 0.26
261 0.25
262 0.23
263 0.19
264 0.2
265 0.19
266 0.2
267 0.19
268 0.19
269 0.2
270 0.22
271 0.2
272 0.19
273 0.18
274 0.15
275 0.18
276 0.25