Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W7VCQ4

Protein Details
Accession A0A0W7VCQ4    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
17-36ARAAKAKKANQKRADPANRSHydrophilic
NLS Segment(s)
PositionSequence
8-73NRPSKNRLAARAAKAKKANQKRADPANRSKITKADKTRGARPGLLPNSGPRAAVSAKKARKLEKKM
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MPSVKNPNRPSKNRLAARAAKAKKANQKRADPANRSKITKADKTRGARPGLLPNSGPRAAVSAKKARKLEKKMGYALKRQMEAEGEAEMKDAPVVEEKAAQGAEDVEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.72
4 0.73
5 0.75
6 0.67
7 0.65
8 0.64
9 0.64
10 0.66
11 0.68
12 0.71
13 0.69
14 0.74
15 0.74
16 0.79
17 0.81
18 0.78
19 0.76
20 0.76
21 0.72
22 0.67
23 0.61
24 0.57
25 0.54
26 0.55
27 0.52
28 0.49
29 0.52
30 0.54
31 0.59
32 0.58
33 0.54
34 0.47
35 0.43
36 0.45
37 0.38
38 0.35
39 0.29
40 0.25
41 0.27
42 0.25
43 0.23
44 0.14
45 0.14
46 0.14
47 0.17
48 0.2
49 0.24
50 0.27
51 0.33
52 0.37
53 0.42
54 0.5
55 0.55
56 0.61
57 0.61
58 0.62
59 0.63
60 0.69
61 0.65
62 0.63
63 0.63
64 0.57
65 0.5
66 0.45
67 0.4
68 0.33
69 0.3
70 0.24
71 0.18
72 0.14
73 0.13
74 0.13
75 0.11
76 0.09
77 0.08
78 0.07
79 0.06
80 0.1
81 0.11
82 0.11
83 0.14
84 0.14
85 0.16
86 0.16
87 0.15
88 0.11
89 0.11