Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZYP0

Protein Details
Accession A0A2P4ZYP0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
14-34GKTLGPSHRRHRKILRDNIKGBasic
117-140REDQDFQRRHRSRRTLYRADRITLHydrophilic
NLS Segment(s)
PositionSequence
19-51PSHRRHRKILRDNIKGITKPAIRRLARRGGVKR
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSSRGGAFRQMVGGKTLGPSHRRHRKILRDNIKGITKPAIRRLARRGGVKRISATVYDETRAAMKQYLEEIIRDAVTYVEHRNAKTVTIHDVLHSLQRRGRTLYGFDPVTWAVPKSREDQDFQRRHRSRRTLYRADRITLDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.22
4 0.22
5 0.25
6 0.31
7 0.39
8 0.49
9 0.53
10 0.6
11 0.66
12 0.71
13 0.77
14 0.82
15 0.82
16 0.79
17 0.79
18 0.77
19 0.73
20 0.62
21 0.53
22 0.5
23 0.44
24 0.4
25 0.44
26 0.47
27 0.44
28 0.48
29 0.53
30 0.55
31 0.55
32 0.6
33 0.57
34 0.56
35 0.59
36 0.56
37 0.51
38 0.43
39 0.39
40 0.31
41 0.3
42 0.24
43 0.2
44 0.19
45 0.17
46 0.15
47 0.15
48 0.14
49 0.11
50 0.09
51 0.08
52 0.08
53 0.09
54 0.11
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.07
62 0.05
63 0.06
64 0.07
65 0.07
66 0.12
67 0.14
68 0.14
69 0.17
70 0.17
71 0.18
72 0.18
73 0.18
74 0.17
75 0.18
76 0.18
77 0.16
78 0.17
79 0.16
80 0.21
81 0.22
82 0.19
83 0.19
84 0.22
85 0.24
86 0.26
87 0.28
88 0.24
89 0.26
90 0.27
91 0.31
92 0.28
93 0.26
94 0.25
95 0.22
96 0.22
97 0.19
98 0.17
99 0.14
100 0.16
101 0.19
102 0.21
103 0.28
104 0.29
105 0.32
106 0.41
107 0.5
108 0.56
109 0.59
110 0.66
111 0.66
112 0.7
113 0.76
114 0.77
115 0.76
116 0.78
117 0.82
118 0.82
119 0.84
120 0.87
121 0.82
122 0.75
123 0.67