Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6H1Y7

Protein Details
Accession C6H1Y7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKMEVKMRRRRRQRPRYILNNNTQPQPHydrophilic
NLS Segment(s)
PositionSequence
8-14RRRRRQR
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR026635  Efm4/METTL10  
IPR025714  Methyltranfer_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF13847  Methyltransf_31  
Amino Acid Sequences MKMEVKMRRRRRQRPRYILNNNTQPQPQPQPQPQPTILDLGTGNGSMLALLRDEGGFTGGQMVGVDYSSKSIELARRLHHGSAGRGRDGEGDGYGGGDRIGADTTTTATSTIRFEVWDVFDKRAVEELDWFPVARGGFDIVLDKGTFDAISLSAEEIAVDVRTVGEPGKKRGEEEEEENVDTKESRVVQRMCERYPEIVRGLVRREGFLVVTSCNWTEEELIKWFTRREAGENEGGDRLVVWDRVEYPKFRFGGQEGQGVCTVCFRRVSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.95
4 0.94
5 0.93
6 0.92
7 0.91
8 0.83
9 0.76
10 0.68
11 0.6
12 0.56
13 0.55
14 0.52
15 0.51
16 0.56
17 0.63
18 0.64
19 0.69
20 0.64
21 0.59
22 0.53
23 0.49
24 0.4
25 0.31
26 0.26
27 0.2
28 0.19
29 0.14
30 0.12
31 0.08
32 0.08
33 0.05
34 0.06
35 0.05
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.06
44 0.06
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.1
59 0.14
60 0.19
61 0.23
62 0.24
63 0.29
64 0.31
65 0.31
66 0.32
67 0.31
68 0.31
69 0.34
70 0.35
71 0.31
72 0.28
73 0.28
74 0.26
75 0.24
76 0.19
77 0.12
78 0.09
79 0.08
80 0.08
81 0.08
82 0.06
83 0.05
84 0.04
85 0.04
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.09
99 0.08
100 0.08
101 0.08
102 0.1
103 0.12
104 0.18
105 0.18
106 0.18
107 0.2
108 0.2
109 0.2
110 0.21
111 0.19
112 0.13
113 0.14
114 0.14
115 0.14
116 0.14
117 0.13
118 0.1
119 0.12
120 0.11
121 0.08
122 0.07
123 0.06
124 0.06
125 0.06
126 0.07
127 0.05
128 0.06
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.05
152 0.1
153 0.12
154 0.16
155 0.23
156 0.23
157 0.24
158 0.27
159 0.32
160 0.31
161 0.33
162 0.36
163 0.31
164 0.31
165 0.31
166 0.28
167 0.22
168 0.19
169 0.15
170 0.12
171 0.12
172 0.14
173 0.21
174 0.22
175 0.28
176 0.36
177 0.41
178 0.39
179 0.41
180 0.41
181 0.38
182 0.4
183 0.37
184 0.3
185 0.28
186 0.29
187 0.27
188 0.29
189 0.29
190 0.27
191 0.24
192 0.24
193 0.21
194 0.2
195 0.19
196 0.16
197 0.12
198 0.13
199 0.15
200 0.14
201 0.14
202 0.14
203 0.12
204 0.13
205 0.14
206 0.16
207 0.17
208 0.2
209 0.2
210 0.22
211 0.22
212 0.22
213 0.25
214 0.24
215 0.26
216 0.28
217 0.32
218 0.36
219 0.36
220 0.36
221 0.31
222 0.29
223 0.24
224 0.19
225 0.16
226 0.13
227 0.13
228 0.11
229 0.12
230 0.16
231 0.23
232 0.27
233 0.28
234 0.3
235 0.36
236 0.37
237 0.36
238 0.36
239 0.32
240 0.38
241 0.38
242 0.4
243 0.33
244 0.35
245 0.36
246 0.34
247 0.3
248 0.27
249 0.26
250 0.23
251 0.24