FuNGI

A0A2K0TH58

Protein Details

Accession

A0A2K0TH58

Localization Confidence

Medium

Confidence Score

13.7

NoLS Segment(s)

Position	Sequence	Protein Nature
372-400	RNSNQDPRLRSRRVRRMAKMNSRKQQQQV	Hydrophilic

NLS Segment(s)

Position	Sequence
383-386	RRVR

Subcellular Location(s)

nucl 22, cyto_nucl 13.5, cyto 3

Family & Domain DBs

Amino Acid Sequences

MQHQAHHQQQGHPPSQPLQHSRPPSIVHQQHHPHSQHPPPQHHQGAYSSQHTLPQAYQAGNQATSTPETLNYYNHPSPYSTPGATSGYTSADTSDMMAAAQMPRPPYPPMSYHTPQSNSPASVASPSQHDQHRNLYGQPQSQHLQQSMYYQPPPQYQSMPHQAAPSPYAQHAHHQQHSMASQPNMMMSHAAQQNQMPPHAAQHAQHAQAGMTGSPRPKIEPQVPLQLQKQQPSPMSQPHHQQGPPQLQSPANPTPAVNPNAAPGPIPATTPLVVRQDGNGVQWIAFEYSRDRVKMEYTIRCDVESVNIEELSPEFKQENCVYPRACCPKDQYRGNRLIYETECNRVGWALAQLNVPLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKMNSRKQQQQVQGAPHPGAHMSGPGGPGGHPGAPAPMPTAHAPNMGKPTIGGMGQPMHHHHAGGHPDGGAPGGEEVGMFHQM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.5
2	0.53
3	0.54
4	0.53
5	0.52
6	0.56
7	0.59
8	0.6
9	0.59
10	0.56
11	0.55
12	0.58
13	0.58
14	0.54
15	0.57
16	0.62
17	0.63
18	0.69
19	0.64
20	0.59
21	0.59
22	0.65
23	0.63
24	0.64
25	0.66
26	0.64
27	0.71
28	0.72
29	0.65
30	0.59
31	0.55
32	0.54
33	0.49
34	0.46
35	0.4
36	0.34
37	0.37
38	0.35
39	0.32
40	0.25
41	0.26
42	0.27
43	0.24
44	0.26
45	0.27
46	0.29
47	0.27
48	0.27
49	0.21
50	0.19
51	0.2
52	0.19
53	0.15
54	0.14
55	0.17
56	0.18
57	0.2
58	0.22
59	0.29
60	0.3
61	0.31
62	0.31
63	0.29
64	0.31
65	0.34
66	0.35
67	0.27
68	0.25
69	0.27
70	0.27
71	0.25
72	0.23
73	0.19
74	0.15
75	0.16
76	0.15
77	0.13
78	0.11
79	0.11
80	0.1
81	0.09
82	0.08
83	0.06
84	0.06
85	0.07
86	0.08
87	0.1
88	0.11
89	0.13
90	0.14
91	0.17
92	0.19
93	0.22
94	0.24
95	0.25
96	0.27
97	0.34
98	0.35
99	0.38
100	0.42
101	0.41
102	0.39
103	0.42
104	0.41
105	0.33
106	0.31
107	0.28
108	0.21
109	0.21
110	0.2
111	0.15
112	0.16
113	0.17
114	0.21
115	0.25
116	0.29
117	0.29
118	0.35
119	0.4
120	0.37
121	0.37
122	0.38
123	0.38
124	0.39
125	0.37
126	0.34
127	0.31
128	0.33
129	0.34
130	0.29
131	0.26
132	0.22
133	0.25
134	0.25
135	0.26
136	0.24
137	0.24
138	0.26
139	0.28
140	0.31
141	0.28
142	0.27
143	0.26
144	0.32
145	0.39
146	0.38
147	0.36
148	0.34
149	0.34
150	0.33
151	0.31
152	0.26
153	0.19
154	0.17
155	0.19
156	0.17
157	0.21
158	0.29
159	0.33
160	0.34
161	0.34
162	0.34
163	0.33
164	0.33
165	0.31
166	0.26
167	0.2
168	0.18
169	0.16
170	0.16
171	0.14
172	0.14
173	0.11
174	0.08
175	0.14
176	0.15
177	0.16
178	0.16
179	0.16
180	0.21
181	0.21
182	0.21
183	0.16
184	0.14
185	0.15
186	0.17
187	0.18
188	0.14
189	0.2
190	0.23
191	0.22
192	0.23
193	0.21
194	0.18
195	0.18
196	0.18
197	0.11
198	0.08
199	0.09
200	0.1
201	0.11
202	0.12
203	0.13
204	0.15
205	0.2
206	0.23
207	0.27
208	0.29
209	0.37
210	0.38
211	0.39
212	0.38
213	0.4
214	0.38
215	0.35
216	0.35
217	0.29
218	0.29
219	0.29
220	0.31
221	0.31
222	0.33
223	0.33
224	0.36
225	0.35
226	0.38
227	0.35
228	0.35
229	0.35
230	0.38
231	0.37
232	0.33
233	0.33
234	0.28
235	0.29
236	0.32
237	0.29
238	0.22
239	0.21
240	0.19
241	0.21
242	0.26
243	0.27
244	0.21
245	0.18
246	0.18
247	0.18
248	0.18
249	0.14
250	0.09
251	0.1
252	0.09
253	0.09
254	0.09
255	0.1
256	0.1
257	0.11
258	0.14
259	0.13
260	0.14
261	0.13
262	0.13
263	0.15
264	0.15
265	0.15
266	0.13
267	0.11
268	0.1
269	0.1
270	0.11
271	0.09
272	0.08
273	0.08
274	0.08
275	0.12
276	0.15
277	0.15
278	0.15
279	0.15
280	0.17
281	0.23
282	0.27
283	0.29
284	0.32
285	0.37
286	0.37
287	0.36
288	0.34
289	0.28
290	0.26
291	0.22
292	0.18
293	0.15
294	0.14
295	0.14
296	0.14
297	0.14
298	0.13
299	0.1
300	0.1
301	0.09
302	0.1
303	0.15
304	0.17
305	0.24
306	0.24
307	0.29
308	0.28
309	0.3
310	0.38
311	0.42
312	0.41
313	0.37
314	0.41
315	0.46
316	0.55
317	0.62
318	0.63
319	0.62
320	0.69
321	0.69
322	0.65
323	0.56
324	0.52
325	0.45
326	0.43
327	0.36
328	0.32
329	0.3
330	0.27
331	0.26
332	0.21
333	0.18
334	0.13
335	0.16
336	0.13
337	0.14
338	0.15
339	0.15
340	0.17
341	0.21
342	0.21
343	0.17
344	0.18
345	0.18
346	0.19
347	0.23
348	0.3
349	0.34
350	0.37
351	0.39
352	0.39
353	0.41
354	0.46
355	0.46
356	0.39
357	0.37
358	0.39
359	0.41
360	0.4
361	0.43
362	0.46
363	0.49
364	0.52
365	0.57
366	0.6
367	0.63
368	0.71
369	0.74
370	0.77
371	0.79
372	0.84
373	0.83
374	0.84
375	0.87
376	0.89
377	0.89
378	0.88
379	0.87
380	0.85
381	0.84
382	0.8
383	0.78
384	0.75
385	0.74
386	0.7
387	0.68
388	0.66
389	0.62
390	0.56
391	0.48
392	0.4
393	0.31
394	0.25
395	0.18
396	0.13
397	0.11
398	0.13
399	0.13
400	0.12
401	0.12
402	0.11
403	0.14
404	0.14
405	0.14
406	0.12
407	0.12
408	0.14
409	0.14
410	0.15
411	0.15
412	0.14
413	0.16
414	0.18
415	0.22
416	0.2
417	0.26
418	0.27
419	0.3
420	0.35
421	0.32
422	0.3
423	0.26
424	0.27
425	0.23
426	0.22
427	0.17
428	0.14
429	0.17
430	0.19
431	0.22
432	0.24
433	0.27
434	0.28
435	0.28
436	0.26
437	0.29
438	0.33
439	0.32
440	0.29
441	0.23
442	0.23
443	0.23
444	0.23
445	0.16
446	0.11
447	0.08
448	0.07
449	0.07
450	0.06
451	0.07

A0A2K0TH58

3D AlphaFold-predicted Structure Viewer