Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZB63

Protein Details
Accession A0A2P4ZB63   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21DCQKWREKVKIKFQGRKITSNHydrophilic
57-103GGRSRASDDKTRRKKHRHRERTATWETPRRNRKGRRGIWQPERPKKEBasic
NLS Segment(s)
PositionSequence
57-103GGRSRASDDKTRRKKHRHRERTATWETPRRNRKGRRGIWQPERPKKE
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences DCQKWREKVKIKFQGRKITSNSENHAVNHALWAVAPHPPLQRSDSTAAGNDLNSRPGGRSRASDDKTRRKKHRHRERTATWETPRRNRKGRRGIWQPERPKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.78
4 0.72
5 0.7
6 0.66
7 0.62
8 0.59
9 0.53
10 0.5
11 0.43
12 0.41
13 0.34
14 0.27
15 0.22
16 0.18
17 0.13
18 0.1
19 0.1
20 0.08
21 0.08
22 0.09
23 0.11
24 0.13
25 0.14
26 0.16
27 0.18
28 0.18
29 0.2
30 0.22
31 0.21
32 0.2
33 0.2
34 0.19
35 0.16
36 0.15
37 0.13
38 0.11
39 0.1
40 0.09
41 0.09
42 0.09
43 0.11
44 0.14
45 0.13
46 0.15
47 0.2
48 0.3
49 0.32
50 0.4
51 0.46
52 0.54
53 0.64
54 0.71
55 0.75
56 0.77
57 0.85
58 0.88
59 0.9
60 0.91
61 0.9
62 0.91
63 0.89
64 0.88
65 0.85
66 0.82
67 0.77
68 0.75
69 0.72
70 0.72
71 0.73
72 0.72
73 0.75
74 0.77
75 0.81
76 0.83
77 0.84
78 0.85
79 0.86
80 0.88
81 0.88
82 0.89
83 0.89