Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZNA3

Protein Details
Accession A0A2P4ZNA3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
227-255SSNGGAPRKPGRPKKNGSKEKKAAPPPALHydrophilic
NLS Segment(s)
PositionSequence
231-263GAPRKPGRPKKNGSKEKKAAPPPALGKTARKTR
Subcellular Location(s) nucl 14, cyto_nucl 13.333, cyto 11.5, mito_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MADSIAPAVDKVGAPEPTAPEALAGAPTLDTAKPEVSENPLAQAEPSKELPIIGETKAVEDAKSSTEPFNVIEAFKKAHQIPRPVEVQSVPETPANQSVNGSPKPELNISMETEESPKPQEEPVVITGVEEPLPTPAASVPNSDNGPDSIVDKPVTPNGESKPAEMAGALQSGNDDDKSDVSEIVIGEKRKLAEGPADVSATAPEKEDSDESERADKKAKIDDGEASSNGGAPRKPGRPKKNGSKEKKAAPPPALGKTARKTRSQGPVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.23
4 0.24
5 0.24
6 0.21
7 0.16
8 0.16
9 0.15
10 0.12
11 0.09
12 0.07
13 0.06
14 0.07
15 0.09
16 0.08
17 0.09
18 0.1
19 0.11
20 0.12
21 0.14
22 0.16
23 0.2
24 0.24
25 0.23
26 0.25
27 0.24
28 0.23
29 0.22
30 0.24
31 0.21
32 0.2
33 0.21
34 0.19
35 0.18
36 0.18
37 0.19
38 0.17
39 0.17
40 0.14
41 0.15
42 0.14
43 0.15
44 0.18
45 0.18
46 0.14
47 0.13
48 0.14
49 0.15
50 0.17
51 0.17
52 0.15
53 0.15
54 0.16
55 0.16
56 0.17
57 0.15
58 0.13
59 0.14
60 0.15
61 0.16
62 0.16
63 0.2
64 0.21
65 0.27
66 0.32
67 0.37
68 0.38
69 0.41
70 0.43
71 0.39
72 0.37
73 0.31
74 0.28
75 0.24
76 0.22
77 0.19
78 0.17
79 0.17
80 0.17
81 0.22
82 0.2
83 0.17
84 0.16
85 0.17
86 0.22
87 0.23
88 0.23
89 0.18
90 0.19
91 0.21
92 0.2
93 0.19
94 0.16
95 0.17
96 0.17
97 0.17
98 0.16
99 0.14
100 0.16
101 0.15
102 0.13
103 0.12
104 0.11
105 0.11
106 0.11
107 0.12
108 0.1
109 0.12
110 0.13
111 0.12
112 0.12
113 0.11
114 0.11
115 0.1
116 0.1
117 0.07
118 0.05
119 0.05
120 0.06
121 0.05
122 0.05
123 0.06
124 0.08
125 0.09
126 0.1
127 0.1
128 0.13
129 0.13
130 0.13
131 0.13
132 0.11
133 0.11
134 0.1
135 0.11
136 0.09
137 0.1
138 0.1
139 0.1
140 0.11
141 0.12
142 0.14
143 0.13
144 0.16
145 0.16
146 0.24
147 0.24
148 0.23
149 0.23
150 0.21
151 0.2
152 0.17
153 0.16
154 0.08
155 0.09
156 0.08
157 0.06
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.08
168 0.07
169 0.09
170 0.08
171 0.12
172 0.15
173 0.14
174 0.14
175 0.16
176 0.16
177 0.16
178 0.16
179 0.14
180 0.14
181 0.16
182 0.18
183 0.18
184 0.17
185 0.16
186 0.16
187 0.16
188 0.14
189 0.12
190 0.1
191 0.09
192 0.1
193 0.12
194 0.12
195 0.15
196 0.19
197 0.21
198 0.22
199 0.29
200 0.3
201 0.3
202 0.35
203 0.33
204 0.31
205 0.37
206 0.39
207 0.33
208 0.34
209 0.38
210 0.37
211 0.38
212 0.35
213 0.28
214 0.24
215 0.24
216 0.23
217 0.2
218 0.16
219 0.17
220 0.24
221 0.31
222 0.41
223 0.5
224 0.59
225 0.67
226 0.77
227 0.84
228 0.88
229 0.9
230 0.9
231 0.91
232 0.88
233 0.87
234 0.87
235 0.85
236 0.82
237 0.75
238 0.74
239 0.69
240 0.66
241 0.63
242 0.56
243 0.55
244 0.55
245 0.61
246 0.57
247 0.57
248 0.57
249 0.59
250 0.67