Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W7VH88

Protein Details
Accession A0A0W7VH88    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
92-130GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
99-127KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MHSIIRLARPLLAPRISPLSQRTFSCLSPLRPTLTSTFRPNNSFTPSPTAAATASSTETTTADVVPKTALSMHPSLQGAMQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.32
4 0.33
5 0.34
6 0.35
7 0.37
8 0.37
9 0.39
10 0.35
11 0.34
12 0.38
13 0.38
14 0.34
15 0.36
16 0.38
17 0.36
18 0.34
19 0.36
20 0.33
21 0.34
22 0.35
23 0.36
24 0.4
25 0.4
26 0.41
27 0.42
28 0.41
29 0.42
30 0.39
31 0.34
32 0.34
33 0.32
34 0.3
35 0.27
36 0.25
37 0.18
38 0.17
39 0.16
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.07
57 0.08
58 0.1
59 0.1
60 0.13
61 0.13
62 0.13
63 0.13
64 0.15
65 0.14
66 0.13
67 0.14
68 0.12
69 0.13
70 0.16
71 0.16
72 0.18
73 0.17
74 0.22
75 0.23
76 0.28
77 0.3
78 0.31
79 0.32
80 0.31
81 0.38
82 0.42
83 0.46
84 0.47
85 0.51
86 0.57
87 0.65
88 0.72
89 0.71
90 0.73
91 0.77
92 0.81
93 0.84
94 0.82
95 0.82
96 0.82
97 0.84
98 0.84
99 0.83
100 0.82
101 0.83
102 0.87
103 0.88
104 0.89
105 0.89
106 0.9
107 0.91
108 0.91
109 0.9
110 0.9