Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P5A243

Protein Details
Accession A0A2P5A243    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-96HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MARRLILQPAKTANLATMASLLRTFSITTGLLRSAQAVKPLMASPVSTWMGWLSKPAIAGSLQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.16
4 0.15
5 0.12
6 0.12
7 0.12
8 0.12
9 0.09
10 0.09
11 0.09
12 0.07
13 0.09
14 0.09
15 0.1
16 0.11
17 0.11
18 0.11
19 0.11
20 0.13
21 0.14
22 0.14
23 0.17
24 0.16
25 0.15
26 0.16
27 0.16
28 0.16
29 0.12
30 0.12
31 0.09
32 0.13
33 0.14
34 0.12
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.12
48 0.16
49 0.16
50 0.19
51 0.19
52 0.19
53 0.2
54 0.2
55 0.17
56 0.15
57 0.24
58 0.28
59 0.36
60 0.41
61 0.48
62 0.54
63 0.58
64 0.65
65 0.64
66 0.66
67 0.68
68 0.73
69 0.76
70 0.79
71 0.82
72 0.82
73 0.82
74 0.83
75 0.84
76 0.84
77 0.81
78 0.79
79 0.78
80 0.73
81 0.68
82 0.65
83 0.57
84 0.51
85 0.43
86 0.36
87 0.36
88 0.39
89 0.46
90 0.49
91 0.55