Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZXJ5

Protein Details
Accession A0A2P4ZXJ5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-44MKEGRKLACRLCQKRKKKCNRKSPCSMCIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MSSVGPTSAPSKVMKEGRKLACRLCQKRKKKCNRKSPCSMCIKLKVVCQPSTPAPTRKRRQSTKDLFARLAWCEEQLRRTIDARNQCDECLPSTETSADEVAEKLSEIRSASKAPSAAATAKPYSRSRPVQQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.51
4 0.57
5 0.63
6 0.63
7 0.6
8 0.61
9 0.66
10 0.69
11 0.7
12 0.72
13 0.75
14 0.84
15 0.89
16 0.92
17 0.93
18 0.93
19 0.93
20 0.94
21 0.92
22 0.92
23 0.9
24 0.88
25 0.85
26 0.8
27 0.74
28 0.7
29 0.65
30 0.56
31 0.52
32 0.5
33 0.45
34 0.42
35 0.38
36 0.34
37 0.33
38 0.36
39 0.36
40 0.37
41 0.4
42 0.49
43 0.55
44 0.62
45 0.68
46 0.7
47 0.73
48 0.76
49 0.76
50 0.75
51 0.74
52 0.67
53 0.59
54 0.52
55 0.46
56 0.36
57 0.29
58 0.2
59 0.14
60 0.14
61 0.14
62 0.14
63 0.16
64 0.17
65 0.17
66 0.19
67 0.21
68 0.25
69 0.33
70 0.35
71 0.37
72 0.36
73 0.34
74 0.35
75 0.32
76 0.28
77 0.23
78 0.2
79 0.15
80 0.16
81 0.16
82 0.15
83 0.16
84 0.14
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.08
94 0.09
95 0.12
96 0.14
97 0.16
98 0.17
99 0.2
100 0.2
101 0.19
102 0.2
103 0.2
104 0.21
105 0.22
106 0.25
107 0.25
108 0.27
109 0.33
110 0.35
111 0.39
112 0.44
113 0.49