Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZYY5

Protein Details
Accession A0A2P4ZYY5    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-87EPTPVKTPRKKGQPKKKAPKATDFGBasic
NLS Segment(s)
PositionSequence
68-82KTPRKKGQPKKKAPK
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
Amino Acid Sequences MYFETPEKSGVIWTEAAKLREDGRTIKWDKINFPGRNVKSMQNIWTRINKQIADLDTQENNGEPTPVKTPRKKGQPKKKAPKATDFGAGAVDDDFDIKQELLKKRDLDDEEPTAAIKKAKVKSEANGNLRVKKENAKEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.26
4 0.26
5 0.26
6 0.25
7 0.27
8 0.28
9 0.25
10 0.25
11 0.33
12 0.35
13 0.39
14 0.43
15 0.42
16 0.43
17 0.49
18 0.54
19 0.47
20 0.5
21 0.54
22 0.5
23 0.51
24 0.51
25 0.45
26 0.42
27 0.42
28 0.42
29 0.39
30 0.41
31 0.4
32 0.45
33 0.43
34 0.42
35 0.44
36 0.38
37 0.33
38 0.34
39 0.31
40 0.26
41 0.26
42 0.23
43 0.19
44 0.19
45 0.18
46 0.13
47 0.13
48 0.1
49 0.09
50 0.06
51 0.08
52 0.12
53 0.19
54 0.25
55 0.29
56 0.36
57 0.43
58 0.53
59 0.62
60 0.68
61 0.73
62 0.78
63 0.85
64 0.89
65 0.91
66 0.9
67 0.84
68 0.82
69 0.75
70 0.66
71 0.6
72 0.49
73 0.39
74 0.3
75 0.26
76 0.17
77 0.13
78 0.1
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.05
85 0.07
86 0.15
87 0.21
88 0.23
89 0.29
90 0.3
91 0.31
92 0.39
93 0.41
94 0.38
95 0.38
96 0.39
97 0.35
98 0.33
99 0.31
100 0.25
101 0.23
102 0.2
103 0.18
104 0.22
105 0.27
106 0.33
107 0.39
108 0.41
109 0.45
110 0.54
111 0.6
112 0.57
113 0.61
114 0.6
115 0.6
116 0.59
117 0.59
118 0.51
119 0.51