Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZYH9

Protein Details
Accession A0A2P4ZYH9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-83LTSLWRKTLRQGQERKRARASRRSRHydrophilic
NLS Segment(s)
PositionSequence
70-83GQERKRARASRRSR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MRLKDRSSKLPEPTAVSDSPGRPITDQTRRPQHQAASGPSHKRSLSPQPKIQVGLWISLTSLWRKTLRQGQERKRARASRRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.42
3 0.38
4 0.36
5 0.3
6 0.31
7 0.28
8 0.25
9 0.21
10 0.25
11 0.3
12 0.36
13 0.41
14 0.45
15 0.53
16 0.55
17 0.58
18 0.58
19 0.52
20 0.49
21 0.48
22 0.44
23 0.41
24 0.44
25 0.43
26 0.4
27 0.4
28 0.34
29 0.3
30 0.3
31 0.34
32 0.39
33 0.42
34 0.45
35 0.46
36 0.48
37 0.49
38 0.45
39 0.4
40 0.3
41 0.26
42 0.22
43 0.18
44 0.16
45 0.15
46 0.16
47 0.13
48 0.14
49 0.16
50 0.18
51 0.19
52 0.26
53 0.33
54 0.41
55 0.49
56 0.58
57 0.64
58 0.73
59 0.81
60 0.81
61 0.82
62 0.82
63 0.81