Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZLB5

Protein Details
Accession A0A2P4ZLB5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-75GVEDRAWRRRRNRESGKGAFGBasic
NLS Segment(s)
Subcellular Location(s) extr 19, plas 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVHWTGLFSVAAGAAAALAGAPCGLVSLLSLFCDACLAFICLRWLCCVAGVGLGVEDRAWRRRRNRESGKGAFGGHSSSLNDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.03
15 0.04
16 0.05
17 0.05
18 0.06
19 0.05
20 0.05
21 0.06
22 0.05
23 0.04
24 0.05
25 0.06
26 0.06
27 0.07
28 0.09
29 0.09
30 0.09
31 0.1
32 0.1
33 0.09
34 0.09
35 0.09
36 0.07
37 0.07
38 0.07
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.06
45 0.08
46 0.15
47 0.2
48 0.28
49 0.37
50 0.48
51 0.58
52 0.67
53 0.76
54 0.79
55 0.84
56 0.83
57 0.79
58 0.71
59 0.62
60 0.53
61 0.42
62 0.34
63 0.26
64 0.21