Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HQE8

Protein Details
Accession C6HQE8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-34QEEPRSKESREREKGHRKRQKPVTRLHYRPIBasic
NLS Segment(s)
PositionSequence
7-25PRSKESREREKGHRKRQKP
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 4
Family & Domain DBs
Amino Acid Sequences MRKQEEPRSKESREREKGHRKRQKPVTRLHYRPIDPSGHQQNWSRLYLKELQQGAGGDGLNLSRRRQNCINCINGRWVNIMIQGGGPDHGKRREINEAGQITQYKNESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.79
4 0.84
5 0.87
6 0.87
7 0.82
8 0.83
9 0.88
10 0.87
11 0.83
12 0.83
13 0.82
14 0.82
15 0.8
16 0.78
17 0.75
18 0.66
19 0.62
20 0.56
21 0.49
22 0.4
23 0.44
24 0.45
25 0.39
26 0.4
27 0.4
28 0.42
29 0.42
30 0.42
31 0.36
32 0.27
33 0.29
34 0.31
35 0.3
36 0.31
37 0.27
38 0.26
39 0.25
40 0.25
41 0.21
42 0.17
43 0.13
44 0.07
45 0.06
46 0.06
47 0.09
48 0.1
49 0.11
50 0.14
51 0.16
52 0.22
53 0.28
54 0.33
55 0.38
56 0.43
57 0.5
58 0.47
59 0.48
60 0.5
61 0.45
62 0.41
63 0.35
64 0.29
65 0.22
66 0.21
67 0.2
68 0.13
69 0.11
70 0.11
71 0.09
72 0.1
73 0.1
74 0.1
75 0.16
76 0.19
77 0.22
78 0.23
79 0.28
80 0.36
81 0.38
82 0.4
83 0.43
84 0.42
85 0.41
86 0.43
87 0.4
88 0.32
89 0.34