Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZTC8

Protein Details
Accession A0A2P4ZTC8   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-44ARPYRRSIFSRRTPRQPRVHHHRKPTLKBasic
NLS Segment(s)
PositionSequence
26-87SRRTPRQPRVHHHRKPTLKDKVSGALTKLKGSLTHRPGVKAAGTRRMRGTDGRGSHRPRRRF
Subcellular Location(s) nucl 11.5, cyto_nucl 10, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MPLTRRHHHTTTTTTTARPYRRSIFSRRTPRQPRVHHHRKPTLKDKVSGALTKLKGSLTHRPGVKAAGTRRMRGTDGRGSHRPRRRFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.5
4 0.5
5 0.46
6 0.45
7 0.44
8 0.5
9 0.54
10 0.57
11 0.59
12 0.63
13 0.7
14 0.71
15 0.75
16 0.77
17 0.81
18 0.82
19 0.81
20 0.8
21 0.8
22 0.84
23 0.8
24 0.81
25 0.81
26 0.79
27 0.78
28 0.78
29 0.77
30 0.69
31 0.64
32 0.56
33 0.52
34 0.47
35 0.4
36 0.32
37 0.29
38 0.27
39 0.25
40 0.24
41 0.19
42 0.2
43 0.23
44 0.31
45 0.28
46 0.33
47 0.34
48 0.35
49 0.35
50 0.34
51 0.33
52 0.3
53 0.3
54 0.34
55 0.36
56 0.37
57 0.4
58 0.41
59 0.4
60 0.38
61 0.4
62 0.39
63 0.43
64 0.47
65 0.53
66 0.57
67 0.65
68 0.7