Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4Z6X4

Protein Details
Accession A0A2P4Z6X4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-143KIDNRQWERKQERKAEKTGNPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 9, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences MEGATADWFSSILKDRQKPLNQQTQLTKDMFKSYKEFKNQLEKSFRITNEAQEAEKKLRDLRQKGPCYKHTSTFIQLLTKVNWTEESKKEMYYYSLKPEVKDEIYKTDQQAVSFTNLTQEAIKIDNRQWERKQERKAEKTGNPVKHHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.48
4 0.55
5 0.62
6 0.66
7 0.71
8 0.66
9 0.67
10 0.69
11 0.64
12 0.62
13 0.54
14 0.47
15 0.38
16 0.42
17 0.38
18 0.33
19 0.33
20 0.36
21 0.42
22 0.47
23 0.49
24 0.47
25 0.56
26 0.57
27 0.6
28 0.6
29 0.53
30 0.52
31 0.54
32 0.48
33 0.42
34 0.39
35 0.34
36 0.33
37 0.33
38 0.28
39 0.24
40 0.27
41 0.24
42 0.24
43 0.22
44 0.2
45 0.25
46 0.32
47 0.35
48 0.42
49 0.49
50 0.56
51 0.62
52 0.65
53 0.65
54 0.65
55 0.62
56 0.57
57 0.52
58 0.47
59 0.42
60 0.39
61 0.34
62 0.27
63 0.26
64 0.23
65 0.19
66 0.18
67 0.16
68 0.13
69 0.15
70 0.16
71 0.2
72 0.2
73 0.25
74 0.24
75 0.24
76 0.25
77 0.22
78 0.23
79 0.24
80 0.23
81 0.23
82 0.3
83 0.31
84 0.3
85 0.32
86 0.33
87 0.3
88 0.32
89 0.28
90 0.27
91 0.3
92 0.33
93 0.32
94 0.35
95 0.33
96 0.3
97 0.29
98 0.24
99 0.24
100 0.22
101 0.2
102 0.16
103 0.15
104 0.16
105 0.15
106 0.13
107 0.11
108 0.13
109 0.16
110 0.16
111 0.19
112 0.27
113 0.32
114 0.4
115 0.43
116 0.52
117 0.59
118 0.65
119 0.72
120 0.73
121 0.79
122 0.79
123 0.83
124 0.81
125 0.78
126 0.8
127 0.8
128 0.78