Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZA78

Protein Details
Accession A0A2P4ZA78   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38GATKCFQRGSRQRKRGPSSAPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MASPPSSQTRHSAVLATGATKCFQRGSRQRKRGPSSAPPTTDTGAGSGAGAGAVGGGAQGRYLAVRIQRRGAGLGEVPVPAGGQRWPGAGKPCPAIGPAWLAAVAAQGSGCRSHTLGRGHDSSKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.2
5 0.17
6 0.17
7 0.16
8 0.16
9 0.16
10 0.18
11 0.27
12 0.36
13 0.46
14 0.56
15 0.66
16 0.73
17 0.79
18 0.83
19 0.8
20 0.77
21 0.76
22 0.73
23 0.7
24 0.65
25 0.57
26 0.53
27 0.46
28 0.4
29 0.29
30 0.22
31 0.15
32 0.12
33 0.09
34 0.06
35 0.05
36 0.04
37 0.04
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.03
50 0.05
51 0.1
52 0.14
53 0.16
54 0.18
55 0.19
56 0.2
57 0.21
58 0.2
59 0.16
60 0.12
61 0.12
62 0.11
63 0.09
64 0.09
65 0.07
66 0.07
67 0.05
68 0.06
69 0.05
70 0.07
71 0.07
72 0.09
73 0.1
74 0.12
75 0.18
76 0.2
77 0.22
78 0.22
79 0.23
80 0.22
81 0.22
82 0.2
83 0.16
84 0.16
85 0.14
86 0.13
87 0.11
88 0.11
89 0.1
90 0.1
91 0.09
92 0.06
93 0.05
94 0.05
95 0.06
96 0.07
97 0.09
98 0.09
99 0.11
100 0.14
101 0.2
102 0.26
103 0.3
104 0.35
105 0.39