Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6H963

Protein Details
Accession C6H963    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
240-269EEQREKEREERYERRRREREKEREEEREKIAcidic
NLS Segment(s)
PositionSequence
184-263KRKQLEIEEAKARAEELRKQRELEKQREEEERKKKLELEEKRRAEREKLREERRLLEEQREKEREERYERRRREREKERE
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Pfam View protein in Pfam  
PF05205  COMPASS-Shg1  
Amino Acid Sequences MAGTEMEMAGVKRPGIDIESLKRKKFKASDLPLSAAQRTSIDSLLYAFKKKGGFDSVRKKIWAEFSESEAKNSLISSLVEMAESEIDRDPSLLSRERGKAATLIEGAVDRSDLYKSVEEAIDSITSNHLDYILESLRIIRRQEVGEEMAALEEERGSKADEYYEREVKTRRKEREIVWLKELEKRKQLEIEEAKARAEELRKQRELEKQREEEERKKKLELEEKRRAEREKLREERRLLEEQREKEREERYERRRREREKEREEEREKIVIVIVDGIGIGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.18
4 0.2
5 0.28
6 0.39
7 0.44
8 0.49
9 0.54
10 0.53
11 0.59
12 0.6
13 0.61
14 0.61
15 0.65
16 0.7
17 0.68
18 0.7
19 0.65
20 0.61
21 0.53
22 0.42
23 0.33
24 0.24
25 0.22
26 0.2
27 0.16
28 0.14
29 0.12
30 0.13
31 0.19
32 0.2
33 0.21
34 0.19
35 0.22
36 0.24
37 0.24
38 0.27
39 0.29
40 0.33
41 0.4
42 0.51
43 0.55
44 0.57
45 0.57
46 0.54
47 0.49
48 0.51
49 0.44
50 0.41
51 0.34
52 0.35
53 0.44
54 0.43
55 0.4
56 0.33
57 0.31
58 0.24
59 0.22
60 0.17
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.08
70 0.08
71 0.08
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.13
79 0.15
80 0.16
81 0.21
82 0.23
83 0.25
84 0.26
85 0.25
86 0.23
87 0.2
88 0.21
89 0.16
90 0.13
91 0.11
92 0.11
93 0.1
94 0.08
95 0.07
96 0.05
97 0.05
98 0.05
99 0.06
100 0.08
101 0.08
102 0.09
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.09
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.05
117 0.05
118 0.08
119 0.07
120 0.07
121 0.07
122 0.09
123 0.11
124 0.13
125 0.14
126 0.12
127 0.14
128 0.14
129 0.15
130 0.16
131 0.15
132 0.12
133 0.12
134 0.1
135 0.08
136 0.07
137 0.06
138 0.04
139 0.03
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.06
146 0.09
147 0.11
148 0.16
149 0.21
150 0.25
151 0.25
152 0.27
153 0.32
154 0.37
155 0.45
156 0.48
157 0.5
158 0.52
159 0.57
160 0.56
161 0.62
162 0.65
163 0.58
164 0.53
165 0.51
166 0.45
167 0.47
168 0.51
169 0.44
170 0.42
171 0.4
172 0.38
173 0.39
174 0.39
175 0.42
176 0.4
177 0.41
178 0.39
179 0.37
180 0.35
181 0.3
182 0.29
183 0.23
184 0.22
185 0.24
186 0.29
187 0.37
188 0.39
189 0.41
190 0.46
191 0.53
192 0.59
193 0.6
194 0.6
195 0.55
196 0.58
197 0.66
198 0.67
199 0.67
200 0.68
201 0.68
202 0.61
203 0.6
204 0.59
205 0.58
206 0.61
207 0.62
208 0.62
209 0.65
210 0.69
211 0.73
212 0.74
213 0.7
214 0.69
215 0.68
216 0.67
217 0.68
218 0.71
219 0.72
220 0.75
221 0.74
222 0.72
223 0.69
224 0.68
225 0.6
226 0.6
227 0.6
228 0.58
229 0.64
230 0.61
231 0.58
232 0.54
233 0.58
234 0.56
235 0.58
236 0.62
237 0.63
238 0.7
239 0.77
240 0.82
241 0.86
242 0.87
243 0.88
244 0.89
245 0.9
246 0.89
247 0.9
248 0.87
249 0.87
250 0.84
251 0.79
252 0.72
253 0.65
254 0.55
255 0.46
256 0.39
257 0.29
258 0.24
259 0.2
260 0.15
261 0.1