Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZS55

Protein Details
Accession A0A2P4ZS55    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
279-305FTRLPQESKKDRAKKAKQANRSGRMQFHydrophilic
NLS Segment(s)
PositionSequence
287-296KKDRAKKAKQ
326-348RKEGGAGSGVRAMLEKSRKRGAE
353-383PRGSGHQMGDRFHKKARLLDIGRGSRGKGRK
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAAATTLPALLASLTQSLSLAQEGTSKISTIEHPKDGISLLDVKNELLLSYLQNLVFLILVKLRNAKSDGKDASKKKDEDLDEVVRSKLVELRLYLEKGARPLEEKLRFSIDRFLRTAEDAQRREKIKEIKDSAKTGSSTDESGSDSEQDEDEDDSEAEETGFSKPQTKNGAAPNMGSLIDDVAIRPAQRSEEDGAPAGVYRPPRRERQVMETTETREKAARRPMRSHTMEEFVASELSSAPMAEPSIGTTIVQGGRRMKTTQERRDEAERTEYEEANFTRLPQESKKDRAKKAKQANRSGRMQFGGEEWHNLGEGIDRIDRLTKRKEGGAGSGVRAMLEKSRKRGAETEDGPRGSGHQMGDRFHKKARLLDIGRGSRGKGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.1
6 0.1
7 0.09
8 0.08
9 0.12
10 0.12
11 0.16
12 0.16
13 0.15
14 0.15
15 0.17
16 0.22
17 0.27
18 0.32
19 0.31
20 0.32
21 0.32
22 0.33
23 0.31
24 0.26
25 0.2
26 0.21
27 0.19
28 0.22
29 0.22
30 0.2
31 0.21
32 0.2
33 0.17
34 0.12
35 0.12
36 0.09
37 0.11
38 0.14
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.11
45 0.09
46 0.1
47 0.11
48 0.13
49 0.19
50 0.19
51 0.23
52 0.26
53 0.31
54 0.31
55 0.39
56 0.43
57 0.45
58 0.53
59 0.55
60 0.61
61 0.63
62 0.61
63 0.55
64 0.57
65 0.52
66 0.49
67 0.5
68 0.46
69 0.41
70 0.41
71 0.38
72 0.31
73 0.28
74 0.23
75 0.2
76 0.17
77 0.16
78 0.15
79 0.19
80 0.23
81 0.24
82 0.24
83 0.23
84 0.22
85 0.23
86 0.24
87 0.2
88 0.19
89 0.22
90 0.3
91 0.34
92 0.34
93 0.34
94 0.38
95 0.38
96 0.37
97 0.42
98 0.36
99 0.34
100 0.34
101 0.33
102 0.28
103 0.3
104 0.33
105 0.32
106 0.37
107 0.36
108 0.39
109 0.43
110 0.44
111 0.44
112 0.46
113 0.46
114 0.43
115 0.5
116 0.52
117 0.54
118 0.56
119 0.57
120 0.52
121 0.47
122 0.42
123 0.33
124 0.29
125 0.23
126 0.19
127 0.17
128 0.16
129 0.13
130 0.13
131 0.13
132 0.1
133 0.1
134 0.1
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.06
149 0.08
150 0.08
151 0.15
152 0.15
153 0.2
154 0.26
155 0.26
156 0.3
157 0.33
158 0.38
159 0.31
160 0.31
161 0.26
162 0.22
163 0.21
164 0.16
165 0.11
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.07
177 0.1
178 0.11
179 0.12
180 0.13
181 0.13
182 0.13
183 0.11
184 0.11
185 0.09
186 0.09
187 0.11
188 0.13
189 0.2
190 0.24
191 0.3
192 0.35
193 0.41
194 0.42
195 0.47
196 0.53
197 0.48
198 0.49
199 0.45
200 0.44
201 0.42
202 0.39
203 0.31
204 0.26
205 0.25
206 0.27
207 0.35
208 0.38
209 0.38
210 0.44
211 0.48
212 0.55
213 0.56
214 0.55
215 0.48
216 0.44
217 0.39
218 0.34
219 0.29
220 0.2
221 0.17
222 0.12
223 0.09
224 0.06
225 0.06
226 0.06
227 0.05
228 0.04
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.06
235 0.06
236 0.06
237 0.06
238 0.09
239 0.12
240 0.13
241 0.15
242 0.18
243 0.2
244 0.23
245 0.23
246 0.26
247 0.33
248 0.42
249 0.48
250 0.53
251 0.54
252 0.57
253 0.62
254 0.6
255 0.53
256 0.5
257 0.42
258 0.39
259 0.39
260 0.35
261 0.29
262 0.3
263 0.28
264 0.24
265 0.24
266 0.18
267 0.19
268 0.2
269 0.24
270 0.24
271 0.33
272 0.35
273 0.44
274 0.54
275 0.6
276 0.68
277 0.75
278 0.8
279 0.81
280 0.85
281 0.85
282 0.85
283 0.86
284 0.88
285 0.84
286 0.82
287 0.74
288 0.67
289 0.6
290 0.51
291 0.4
292 0.31
293 0.31
294 0.23
295 0.23
296 0.2
297 0.18
298 0.17
299 0.17
300 0.15
301 0.11
302 0.11
303 0.11
304 0.12
305 0.12
306 0.12
307 0.19
308 0.22
309 0.26
310 0.32
311 0.35
312 0.37
313 0.41
314 0.45
315 0.41
316 0.43
317 0.44
318 0.39
319 0.35
320 0.35
321 0.31
322 0.26
323 0.24
324 0.2
325 0.2
326 0.27
327 0.31
328 0.34
329 0.42
330 0.44
331 0.48
332 0.53
333 0.53
334 0.54
335 0.54
336 0.57
337 0.57
338 0.55
339 0.51
340 0.45
341 0.4
342 0.32
343 0.31
344 0.24
345 0.23
346 0.26
347 0.28
348 0.38
349 0.42
350 0.44
351 0.45
352 0.5
353 0.47
354 0.51
355 0.55
356 0.56
357 0.53
358 0.58
359 0.63
360 0.62
361 0.63
362 0.58
363 0.52