Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2P4ZLD8

Protein Details
Accession A0A2P4ZLD8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-34YHNGHYHEAPRRDRRHKKRDDSWNVMKVWBasic
NLS Segment(s)
PositionSequence
16-23RRDRRHKK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 3
Family & Domain DBs
Amino Acid Sequences MPELVYHNGHYHEAPRRDRRHKKRDDSWNVMKVWDEVLYNIGDLYYKCYLRTRTATFTRSFHLKKSPRSSTARIVGSQTARIRALLSVPWLREKGDGPCESLTGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.6
4 0.7
5 0.8
6 0.85
7 0.86
8 0.89
9 0.9
10 0.9
11 0.92
12 0.91
13 0.89
14 0.87
15 0.82
16 0.71
17 0.62
18 0.52
19 0.41
20 0.32
21 0.24
22 0.15
23 0.09
24 0.1
25 0.09
26 0.08
27 0.08
28 0.06
29 0.06
30 0.06
31 0.1
32 0.11
33 0.11
34 0.12
35 0.16
36 0.18
37 0.21
38 0.27
39 0.26
40 0.3
41 0.34
42 0.37
43 0.36
44 0.35
45 0.33
46 0.36
47 0.33
48 0.29
49 0.35
50 0.38
51 0.44
52 0.52
53 0.55
54 0.55
55 0.6
56 0.62
57 0.6
58 0.61
59 0.55
60 0.47
61 0.43
62 0.4
63 0.35
64 0.37
65 0.31
66 0.27
67 0.25
68 0.24
69 0.23
70 0.19
71 0.19
72 0.14
73 0.18
74 0.19
75 0.21
76 0.25
77 0.25
78 0.26
79 0.26
80 0.28
81 0.29
82 0.33
83 0.33
84 0.32
85 0.33