Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H8N1

Protein Details
Accession C6H8N1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-42FLNSKQKSKSKKVGKGGRRWYKDHydrophilic
NLS Segment(s)
PositionSequence
24-38KQKSKSKKVGKGGRR
Subcellular Location(s) nucl 9cyto_nucl 9, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16205  Ribosomal_S17_N  
Amino Acid Sequences MATELTVQSERAFQKQPHIFLNSKQKSKSKKVGKGGRRWYKDVGLGFRTPKTAIEGSYIDKKCPFIGQVSIRGRILTVQTSEQTVRFNVLRVLPRTGKAVKQFGKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.44
4 0.43
5 0.46
6 0.43
7 0.45
8 0.55
9 0.53
10 0.52
11 0.54
12 0.56
13 0.59
14 0.66
15 0.69
16 0.68
17 0.69
18 0.75
19 0.79
20 0.81
21 0.83
22 0.85
23 0.85
24 0.79
25 0.74
26 0.66
27 0.59
28 0.54
29 0.47
30 0.41
31 0.34
32 0.31
33 0.29
34 0.27
35 0.25
36 0.21
37 0.18
38 0.18
39 0.15
40 0.13
41 0.14
42 0.15
43 0.16
44 0.25
45 0.25
46 0.22
47 0.22
48 0.22
49 0.2
50 0.2
51 0.18
52 0.11
53 0.18
54 0.2
55 0.28
56 0.31
57 0.33
58 0.32
59 0.3
60 0.28
61 0.24
62 0.23
63 0.16
64 0.15
65 0.14
66 0.15
67 0.18
68 0.19
69 0.18
70 0.18
71 0.16
72 0.18
73 0.16
74 0.17
75 0.18
76 0.22
77 0.28
78 0.29
79 0.36
80 0.35
81 0.36
82 0.41
83 0.41
84 0.42
85 0.43
86 0.5