Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0T7F5

Protein Details
Accession A0A2K0T7F5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-124EDKARVLEKTKKRNTHFPQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
86-119PKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRK
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTGKVRASQLWGKNKEELAKQLGELKAELGQLRIQKVASSGSKLNKIHDLRKSIARVLTVTNATQRNQLRLFYKKSKYLPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.53
4 0.49
5 0.45
6 0.4
7 0.36
8 0.33
9 0.35
10 0.33
11 0.29
12 0.25
13 0.21
14 0.18
15 0.18
16 0.18
17 0.12
18 0.14
19 0.16
20 0.17
21 0.17
22 0.15
23 0.14
24 0.15
25 0.18
26 0.16
27 0.17
28 0.2
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.37
39 0.42
40 0.42
41 0.36
42 0.34
43 0.29
44 0.24
45 0.21
46 0.21
47 0.16
48 0.14
49 0.16
50 0.17
51 0.17
52 0.22
53 0.22
54 0.24
55 0.24
56 0.26
57 0.26
58 0.29
59 0.36
60 0.38
61 0.42
62 0.44
63 0.46
64 0.51
65 0.5
66 0.52
67 0.53
68 0.53
69 0.6
70 0.58
71 0.64
72 0.6
73 0.59
74 0.59
75 0.58
76 0.6
77 0.57
78 0.64
79 0.61
80 0.64
81 0.71
82 0.73
83 0.74
84 0.73
85 0.74
86 0.71
87 0.67
88 0.63
89 0.56
90 0.53
91 0.52
92 0.53
93 0.53
94 0.56
95 0.63
96 0.7
97 0.74
98 0.79
99 0.82
100 0.83
101 0.85
102 0.82
103 0.83
104 0.8