Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B5RTW1

Protein Details
Accession B5RTW1   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
161-192MEIRKKIKESKLKELKKSKKLSIKKGPVHVKVBasic
206-225ENKVVNTRNKWLKRKSLGKKHydrophilic
NLS Segment(s)
PositionSequence
164-187RKKIKESKLKELKKSKKLSIKKGP
213-225RNKWLKRKSLGKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
KEGG dha:DEHA2E05324g  -  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MVVTRSRLNAKAGNGATPKKMKFSDNDADVNDIEYHTAEEDELNQSAGSQDSDSDSDSDSDEAPEEESTSGIRNEILAKQKEDLKSQQELKKLEKERRRQQNVYNQQQQLLKKNKKQEDKLPEYLPEDIFESISDNETGESEPIIPSKHLKLQDFEKLDEMEIRKKIKESKLKELKKSKKLSIKKGPVHVKVQSFNLDKKVVPKFENKVVNTRNKWLKRKSLGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.47
5 0.45
6 0.43
7 0.45
8 0.41
9 0.4
10 0.46
11 0.48
12 0.45
13 0.48
14 0.43
15 0.43
16 0.39
17 0.36
18 0.28
19 0.2
20 0.15
21 0.12
22 0.11
23 0.09
24 0.09
25 0.07
26 0.07
27 0.09
28 0.11
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.1
35 0.09
36 0.07
37 0.07
38 0.08
39 0.1
40 0.1
41 0.11
42 0.11
43 0.11
44 0.11
45 0.12
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.09
62 0.13
63 0.2
64 0.21
65 0.22
66 0.24
67 0.29
68 0.31
69 0.32
70 0.33
71 0.3
72 0.33
73 0.4
74 0.42
75 0.42
76 0.43
77 0.43
78 0.48
79 0.5
80 0.52
81 0.54
82 0.6
83 0.64
84 0.72
85 0.76
86 0.72
87 0.73
88 0.75
89 0.77
90 0.76
91 0.74
92 0.64
93 0.58
94 0.58
95 0.53
96 0.51
97 0.51
98 0.49
99 0.45
100 0.53
101 0.57
102 0.61
103 0.64
104 0.64
105 0.64
106 0.65
107 0.65
108 0.58
109 0.52
110 0.46
111 0.43
112 0.34
113 0.24
114 0.18
115 0.13
116 0.12
117 0.1
118 0.1
119 0.08
120 0.09
121 0.08
122 0.07
123 0.07
124 0.08
125 0.08
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.08
133 0.1
134 0.12
135 0.18
136 0.22
137 0.23
138 0.25
139 0.29
140 0.37
141 0.37
142 0.35
143 0.33
144 0.29
145 0.28
146 0.29
147 0.27
148 0.24
149 0.26
150 0.28
151 0.26
152 0.29
153 0.36
154 0.41
155 0.49
156 0.5
157 0.56
158 0.65
159 0.71
160 0.78
161 0.81
162 0.82
163 0.82
164 0.83
165 0.81
166 0.8
167 0.82
168 0.82
169 0.83
170 0.83
171 0.8
172 0.83
173 0.83
174 0.79
175 0.76
176 0.71
177 0.66
178 0.59
179 0.55
180 0.54
181 0.49
182 0.46
183 0.45
184 0.41
185 0.36
186 0.4
187 0.45
188 0.42
189 0.41
190 0.46
191 0.47
192 0.53
193 0.61
194 0.56
195 0.58
196 0.61
197 0.68
198 0.65
199 0.68
200 0.7
201 0.71
202 0.78
203 0.77
204 0.79
205 0.79