Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZYK1

Protein Details
Accession A0A2P4ZYK1    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RDRDAFKSRLEKKDERKKGHBasic
NLS Segment(s)
PositionSequence
11-22LEKKDERKKGHA
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MRDRDAFKSRLEKKDERKKGHAPGAAPREMSTYGSPGALPQTRPTPPQRGSFPLDHDGECKKAMTSYLACMKKVRGVNEDECRNLAKAYLSCRMDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.8
4 0.79
5 0.79
6 0.8
7 0.79
8 0.72
9 0.63
10 0.62
11 0.6
12 0.54
13 0.46
14 0.37
15 0.32
16 0.29
17 0.28
18 0.2
19 0.15
20 0.13
21 0.13
22 0.13
23 0.1
24 0.14
25 0.13
26 0.13
27 0.13
28 0.17
29 0.18
30 0.22
31 0.26
32 0.3
33 0.31
34 0.36
35 0.36
36 0.36
37 0.39
38 0.38
39 0.37
40 0.34
41 0.32
42 0.28
43 0.27
44 0.24
45 0.22
46 0.2
47 0.17
48 0.12
49 0.11
50 0.12
51 0.14
52 0.13
53 0.16
54 0.25
55 0.26
56 0.27
57 0.28
58 0.29
59 0.31
60 0.34
61 0.33
62 0.29
63 0.33
64 0.41
65 0.48
66 0.51
67 0.47
68 0.44
69 0.42
70 0.39
71 0.33
72 0.26
73 0.22
74 0.21
75 0.25
76 0.32