FuNGI

C6HLM0

Protein Details

Accession

C6HLM0

Localization Confidence

Low

Confidence Score

8.4

NoLS Segment(s)

Position	Sequence	Protein Nature
550-572	PSGKIMRRVLRDREKEARRKAGL	Basic

NLS Segment(s)

Position	Sequence
550-574	PSGKIMRRVLRDREKEARRKAGLKL

Subcellular Location(s)

cyto 17.5, cyto_nucl 10, mito 5, nucl 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR025110 AMP-bd_C IPR045851 AMP-bd_C_sf IPR020845 AMP-binding_CS IPR000873 AMP-dep_Synth/Lig_com
Gene Ontology	GO:0016874 F:ligase activity
Pfam	View protein in Pfam PF00501 AMP-binding PF13193 AMP-binding_C
PROSITE	View protein in PROSITE PS00455 AMP_BINDING
CDD	cd05911 Firefly_Luc_like

Amino Acid Sequences

MGIAPPEPARYIPLSEFMLNESMAHPLEDSYDPFVCALSGKSYSTVEVAKRVDVLARSLCKELGWHPNEGSEFSRVACIYSVNTIDYLTLCWAIHRCSGVVSAASASYTAPELTHQLKDSGSKSIFACAVNLQIALEAAANAGIPRSRIYIFDLPPQLLGGGKAPDGFKTVEQLIMEGPSLPQLEKLNWQPGQAAKQAAFLCYSSGTSGPPKGVMVTHRNVIAHVLQMKEFEARVRNSLKAPGSRSDYKDVVLGLLPQSHVYSLAVICHAGPYRGDKVVVLPKFEFTQYLNAIEKYRILTLYVVPPIIILMLQNKAQCDKRDLNCVSSICIGAAPLGAETIADVKQWKPSWVVRQGYGLTEITAGVAISNSDDIFPGSCGPLLPDVEVRLVSPDGEEVTGYDQPGELVVRSPSVTLGYLNNEKATKETFRDGWIYTGDVALFRVSPLGNEHVFIVDRVKELIKVKGYQVAPAEMESHLLSHPAVADCCVISVPDHVAGELPKAFVVKSPSAGNDDAAIIKSIQKYVEDHKARYKWLKGGVEFIEAIPKSPSGKIMRRVLRDREKEARRKAGLKL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.27
2	0.26
3	0.26
4	0.25
5	0.24
6	0.2
7	0.19
8	0.15
9	0.15
10	0.14
11	0.14
12	0.12
13	0.1
14	0.14
15	0.14
16	0.16
17	0.18
18	0.18
19	0.18
20	0.18
21	0.18
22	0.14
23	0.14
24	0.13
25	0.13
26	0.14
27	0.15
28	0.17
29	0.18
30	0.18
31	0.2
32	0.23
33	0.21
34	0.25
35	0.26
36	0.25
37	0.25
38	0.24
39	0.25
40	0.22
41	0.24
42	0.25
43	0.28
44	0.29
45	0.3
46	0.3
47	0.26
48	0.27
49	0.29
50	0.32
51	0.31
52	0.32
53	0.31
54	0.35
55	0.35
56	0.35
57	0.32
58	0.24
59	0.22
60	0.19
61	0.22
62	0.18
63	0.18
64	0.16
65	0.15
66	0.13
67	0.16
68	0.17
69	0.14
70	0.14
71	0.13
72	0.13
73	0.13
74	0.12
75	0.1
76	0.11
77	0.1
78	0.12
79	0.14
80	0.16
81	0.18
82	0.18
83	0.17
84	0.16
85	0.18
86	0.17
87	0.15
88	0.13
89	0.11
90	0.1
91	0.1
92	0.09
93	0.07
94	0.07
95	0.07
96	0.07
97	0.06
98	0.07
99	0.11
100	0.14
101	0.17
102	0.17
103	0.18
104	0.18
105	0.23
106	0.24
107	0.27
108	0.24
109	0.25
110	0.24
111	0.26
112	0.27
113	0.23
114	0.22
115	0.16
116	0.17
117	0.15
118	0.14
119	0.11
120	0.09
121	0.09
122	0.08
123	0.07
124	0.05
125	0.04
126	0.04
127	0.04
128	0.04
129	0.05
130	0.05
131	0.05
132	0.06
133	0.09
134	0.1
135	0.11
136	0.18
137	0.24
138	0.26
139	0.32
140	0.33
141	0.31
142	0.31
143	0.3
144	0.23
145	0.16
146	0.15
147	0.1
148	0.09
149	0.09
150	0.11
151	0.11
152	0.11
153	0.13
154	0.14
155	0.12
156	0.14
157	0.15
158	0.15
159	0.14
160	0.14
161	0.12
162	0.12
163	0.12
164	0.08
165	0.08
166	0.08
167	0.09
168	0.08
169	0.1
170	0.11
171	0.12
172	0.17
173	0.21
174	0.26
175	0.26
176	0.27
177	0.27
178	0.28
179	0.31
180	0.29
181	0.27
182	0.2
183	0.24
184	0.24
185	0.22
186	0.21
187	0.17
188	0.14
189	0.13
190	0.13
191	0.08
192	0.08
193	0.09
194	0.11
195	0.12
196	0.11
197	0.11
198	0.11
199	0.11
200	0.12
201	0.15
202	0.19
203	0.2
204	0.21
205	0.22
206	0.22
207	0.21
208	0.21
209	0.17
210	0.14
211	0.14
212	0.14
213	0.12
214	0.13
215	0.13
216	0.13
217	0.12
218	0.12
219	0.14
220	0.15
221	0.19
222	0.21
223	0.22
224	0.22
225	0.27
226	0.28
227	0.27
228	0.29
229	0.29
230	0.33
231	0.36
232	0.38
233	0.38
234	0.35
235	0.31
236	0.29
237	0.25
238	0.19
239	0.15
240	0.12
241	0.08
242	0.08
243	0.08
244	0.07
245	0.07
246	0.07
247	0.07
248	0.06
249	0.06
250	0.05
251	0.06
252	0.06
253	0.06
254	0.05
255	0.07
256	0.07
257	0.06
258	0.06
259	0.09
260	0.12
261	0.12
262	0.12
263	0.11
264	0.14
265	0.21
266	0.21
267	0.2
268	0.18
269	0.18
270	0.19
271	0.19
272	0.17
273	0.11
274	0.14
275	0.13
276	0.15
277	0.15
278	0.16
279	0.16
280	0.16
281	0.16
282	0.12
283	0.12
284	0.1
285	0.09
286	0.09
287	0.1
288	0.12
289	0.12
290	0.11
291	0.1
292	0.1
293	0.09
294	0.08
295	0.07
296	0.04
297	0.05
298	0.06
299	0.08
300	0.09
301	0.1
302	0.13
303	0.16
304	0.17
305	0.22
306	0.28
307	0.28
308	0.37
309	0.38
310	0.37
311	0.38
312	0.37
313	0.32
314	0.26
315	0.23
316	0.14
317	0.13
318	0.1
319	0.06
320	0.06
321	0.05
322	0.04
323	0.03
324	0.03
325	0.03
326	0.03
327	0.05
328	0.05
329	0.05
330	0.06
331	0.07
332	0.13
333	0.14
334	0.15
335	0.17
336	0.21
337	0.29
338	0.36
339	0.38
340	0.34
341	0.36
342	0.36
343	0.33
344	0.31
345	0.23
346	0.15
347	0.13
348	0.12
349	0.08
350	0.07
351	0.06
352	0.04
353	0.04
354	0.03
355	0.03
356	0.04
357	0.04
358	0.04
359	0.04
360	0.05
361	0.05
362	0.06
363	0.06
364	0.06
365	0.06
366	0.06
367	0.07
368	0.09
369	0.09
370	0.1
371	0.1
372	0.11
373	0.11
374	0.11
375	0.1
376	0.1
377	0.1
378	0.09
379	0.08
380	0.07
381	0.07
382	0.07
383	0.07
384	0.06
385	0.09
386	0.1
387	0.09
388	0.09
389	0.08
390	0.08
391	0.09
392	0.09
393	0.06
394	0.07
395	0.07
396	0.08
397	0.08
398	0.09
399	0.08
400	0.09
401	0.09
402	0.09
403	0.1
404	0.14
405	0.17
406	0.18
407	0.2
408	0.2
409	0.19
410	0.2
411	0.22
412	0.21
413	0.2
414	0.24
415	0.23
416	0.25
417	0.28
418	0.27
419	0.25
420	0.22
421	0.2
422	0.16
423	0.15
424	0.13
425	0.1
426	0.1
427	0.08
428	0.07
429	0.06
430	0.08
431	0.07
432	0.08
433	0.1
434	0.14
435	0.14
436	0.15
437	0.15
438	0.15
439	0.15
440	0.15
441	0.15
442	0.12
443	0.12
444	0.14
445	0.14
446	0.17
447	0.19
448	0.24
449	0.25
450	0.26
451	0.27
452	0.33
453	0.33
454	0.32
455	0.32
456	0.29
457	0.25
458	0.23
459	0.24
460	0.16
461	0.17
462	0.13
463	0.12
464	0.1
465	0.1
466	0.09
467	0.08
468	0.1
469	0.1
470	0.11
471	0.11
472	0.12
473	0.11
474	0.11
475	0.11
476	0.09
477	0.08
478	0.09
479	0.1
480	0.12
481	0.12
482	0.12
483	0.13
484	0.14
485	0.16
486	0.15
487	0.14
488	0.11
489	0.12
490	0.12
491	0.14
492	0.2
493	0.19
494	0.2
495	0.23
496	0.24
497	0.28
498	0.29
499	0.26
500	0.21
501	0.2
502	0.19
503	0.17
504	0.16
505	0.12
506	0.15
507	0.17
508	0.17
509	0.17
510	0.18
511	0.21
512	0.26
513	0.36
514	0.38
515	0.4
516	0.48
517	0.51
518	0.57
519	0.62
520	0.61
521	0.57
522	0.6
523	0.64
524	0.56
525	0.58
526	0.53
527	0.48
528	0.43
529	0.36
530	0.36
531	0.28
532	0.28
533	0.22
534	0.22
535	0.21
536	0.21
537	0.28
538	0.29
539	0.37
540	0.45
541	0.53
542	0.6
543	0.67
544	0.74
545	0.77
546	0.79
547	0.79
548	0.78
549	0.79
550	0.81
551	0.82
552	0.83
553	0.83
554	0.79

C6HLM0

3D AlphaFold-predicted Structure Viewer