Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W7VT13

Protein Details
Accession A0A0W7VT13   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
439-466EIPPKPVVSKRGKLKTKNLQPTYKKGQGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 8, mito 6, nucl 5, plas 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF00153  Mito_carr  
Amino Acid Sequences MASLKEETVNPLRPYYRPPTIEQQAEPVSIPSSNPFSGGNSYDVASGAKYASKAKHMLNDLDYKGLVGEPSPSVVESARELVDELIWKYLSVLIGQPFEVAKMILQARDQDEKAAVTVAAEPEAAPAPQVPSRAGSAFDEDSDGEEPAYFTSNDPTIPNPWNQNQPQPEKRPSSRRTESPLQSPTTPKKEVVLPEHFLNLRRPDAILDVIGQLWQRDGAWGVWKGANATFLYTVLQSLLENWSRSFLSAVFNVPDLGVKDSIDRVVDIASPYPWASLLVAAAAAVTTSLALAPLDLIRTRLILTNPFKGQRRTIASLRALPSYYCPPAIVAPTILHSLINPLFTLSTPLALKTKFMVTSELAPMTFSVAKFVASSVGILIKLPLETVLRRGQLSVLSEPEYLEALNDGEPALETIVPIGKYYGVFGTMYHIVTEEGNREIPPKPVVSKRGKLKTKNLQPTYKKGQGMEGLWRGWRIGWWGLVGLWGANMVGHGGDGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.5
4 0.46
5 0.5
6 0.54
7 0.6
8 0.63
9 0.57
10 0.56
11 0.49
12 0.47
13 0.42
14 0.33
15 0.26
16 0.21
17 0.21
18 0.17
19 0.19
20 0.18
21 0.19
22 0.18
23 0.2
24 0.23
25 0.24
26 0.23
27 0.19
28 0.19
29 0.19
30 0.18
31 0.16
32 0.12
33 0.11
34 0.1
35 0.11
36 0.12
37 0.17
38 0.19
39 0.24
40 0.29
41 0.31
42 0.38
43 0.4
44 0.43
45 0.43
46 0.47
47 0.43
48 0.41
49 0.37
50 0.29
51 0.25
52 0.21
53 0.16
54 0.09
55 0.1
56 0.09
57 0.1
58 0.11
59 0.1
60 0.11
61 0.11
62 0.12
63 0.12
64 0.14
65 0.12
66 0.12
67 0.13
68 0.12
69 0.13
70 0.14
71 0.13
72 0.13
73 0.13
74 0.12
75 0.12
76 0.14
77 0.13
78 0.11
79 0.14
80 0.14
81 0.15
82 0.15
83 0.16
84 0.13
85 0.13
86 0.13
87 0.1
88 0.07
89 0.11
90 0.13
91 0.13
92 0.14
93 0.17
94 0.21
95 0.26
96 0.26
97 0.22
98 0.22
99 0.21
100 0.2
101 0.18
102 0.13
103 0.09
104 0.11
105 0.1
106 0.09
107 0.08
108 0.08
109 0.08
110 0.09
111 0.08
112 0.07
113 0.07
114 0.09
115 0.11
116 0.13
117 0.12
118 0.13
119 0.15
120 0.16
121 0.17
122 0.15
123 0.17
124 0.17
125 0.16
126 0.15
127 0.13
128 0.15
129 0.14
130 0.13
131 0.09
132 0.08
133 0.08
134 0.08
135 0.1
136 0.08
137 0.07
138 0.1
139 0.1
140 0.11
141 0.12
142 0.14
143 0.16
144 0.18
145 0.21
146 0.24
147 0.27
148 0.35
149 0.36
150 0.42
151 0.45
152 0.52
153 0.57
154 0.59
155 0.63
156 0.62
157 0.67
158 0.7
159 0.67
160 0.68
161 0.65
162 0.63
163 0.64
164 0.65
165 0.62
166 0.6
167 0.6
168 0.52
169 0.49
170 0.5
171 0.49
172 0.46
173 0.44
174 0.37
175 0.34
176 0.35
177 0.37
178 0.38
179 0.37
180 0.33
181 0.32
182 0.34
183 0.33
184 0.31
185 0.31
186 0.27
187 0.22
188 0.2
189 0.2
190 0.17
191 0.18
192 0.16
193 0.12
194 0.1
195 0.09
196 0.08
197 0.09
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.06
205 0.06
206 0.1
207 0.11
208 0.12
209 0.13
210 0.13
211 0.14
212 0.13
213 0.14
214 0.1
215 0.1
216 0.09
217 0.08
218 0.09
219 0.08
220 0.07
221 0.06
222 0.06
223 0.05
224 0.05
225 0.08
226 0.09
227 0.1
228 0.1
229 0.11
230 0.11
231 0.11
232 0.11
233 0.09
234 0.09
235 0.09
236 0.1
237 0.09
238 0.09
239 0.09
240 0.09
241 0.09
242 0.07
243 0.08
244 0.08
245 0.07
246 0.08
247 0.08
248 0.09
249 0.08
250 0.07
251 0.06
252 0.06
253 0.07
254 0.07
255 0.07
256 0.06
257 0.07
258 0.07
259 0.07
260 0.06
261 0.06
262 0.05
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.03
269 0.03
270 0.02
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.03
280 0.03
281 0.04
282 0.05
283 0.06
284 0.06
285 0.07
286 0.08
287 0.1
288 0.11
289 0.18
290 0.21
291 0.25
292 0.28
293 0.32
294 0.36
295 0.36
296 0.37
297 0.36
298 0.4
299 0.4
300 0.4
301 0.42
302 0.41
303 0.44
304 0.43
305 0.38
306 0.31
307 0.26
308 0.26
309 0.24
310 0.23
311 0.18
312 0.16
313 0.15
314 0.16
315 0.17
316 0.15
317 0.11
318 0.1
319 0.11
320 0.12
321 0.12
322 0.1
323 0.08
324 0.12
325 0.11
326 0.12
327 0.1
328 0.09
329 0.1
330 0.1
331 0.13
332 0.09
333 0.11
334 0.11
335 0.12
336 0.15
337 0.15
338 0.16
339 0.14
340 0.17
341 0.15
342 0.16
343 0.18
344 0.16
345 0.2
346 0.21
347 0.2
348 0.17
349 0.16
350 0.15
351 0.15
352 0.16
353 0.12
354 0.12
355 0.12
356 0.12
357 0.12
358 0.12
359 0.11
360 0.09
361 0.09
362 0.07
363 0.08
364 0.08
365 0.08
366 0.08
367 0.07
368 0.07
369 0.07
370 0.07
371 0.08
372 0.09
373 0.13
374 0.18
375 0.2
376 0.2
377 0.2
378 0.2
379 0.21
380 0.24
381 0.22
382 0.2
383 0.2
384 0.2
385 0.2
386 0.2
387 0.17
388 0.13
389 0.11
390 0.09
391 0.07
392 0.07
393 0.07
394 0.06
395 0.06
396 0.06
397 0.07
398 0.07
399 0.06
400 0.05
401 0.06
402 0.1
403 0.1
404 0.1
405 0.1
406 0.1
407 0.11
408 0.12
409 0.12
410 0.1
411 0.1
412 0.1
413 0.14
414 0.15
415 0.15
416 0.14
417 0.14
418 0.13
419 0.14
420 0.16
421 0.13
422 0.13
423 0.14
424 0.15
425 0.17
426 0.17
427 0.2
428 0.22
429 0.23
430 0.28
431 0.34
432 0.43
433 0.5
434 0.57
435 0.64
436 0.71
437 0.76
438 0.78
439 0.81
440 0.83
441 0.85
442 0.87
443 0.85
444 0.85
445 0.83
446 0.84
447 0.83
448 0.8
449 0.73
450 0.63
451 0.6
452 0.56
453 0.52
454 0.52
455 0.47
456 0.41
457 0.39
458 0.38
459 0.33
460 0.27
461 0.26
462 0.21
463 0.2
464 0.2
465 0.19
466 0.19
467 0.18
468 0.19
469 0.18
470 0.13
471 0.09
472 0.08
473 0.07
474 0.06
475 0.06
476 0.05
477 0.04
478 0.04