Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZZ14

Protein Details
Accession A0A2P4ZZ14   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-80GLETLKFYPHRQKKRDRPRSSDVTQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, mito 5, extr 5, cyto_pero 5, plas 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQNCSTTDETVSVKDSPWVVWQHPVSAIALLTVILSIIILAAAFVSNACLPVYSFGLETLKFYPHRQKKRDRPRSSDVTQHRQLENQYALPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.2
5 0.21
6 0.2
7 0.26
8 0.26
9 0.25
10 0.25
11 0.25
12 0.2
13 0.17
14 0.16
15 0.09
16 0.08
17 0.06
18 0.05
19 0.04
20 0.03
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.07
40 0.06
41 0.07
42 0.07
43 0.08
44 0.08
45 0.1
46 0.1
47 0.13
48 0.14
49 0.17
50 0.27
51 0.36
52 0.46
53 0.53
54 0.63
55 0.7
56 0.81
57 0.89
58 0.87
59 0.86
60 0.84
61 0.85
62 0.78
63 0.77
64 0.74
65 0.72
66 0.71
67 0.68
68 0.61
69 0.56
70 0.54
71 0.51
72 0.46
73 0.4