Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P4ZLB4

Protein Details
Accession A0A2P4ZLB4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-118AASPKKSTTTTKKSNLPKKQDTDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 10.5, cysk 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007817  Isocyanide_synthase_DIT1  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF05141  DIT1_PvcA  
Amino Acid Sequences MSVLASKLIAINIVDLQDGSHVITDAHSTNNFDRLAKLEAQVTELSQWKNSMTPIISNSIAGSNTASNSGSSSDSESDSNQSVGSLDPNSLMVRHAASPKKSTTTTKKSNLPKKQDTDVTSRIMTIIQGYGQNEENDEGSPWLGRIKFEPRVRKHVKANAPIELVLPAFPWKSVNKVEKVLGAVPDLGEELGLGRLQNLCEDIQAIYPPGAYVTITSDGLVYNDLLGISNEEVYEYGGALRRMAEEKGYDRLKFIRIMNLLGLTDSPHMTKEEYLGCVDDSRKMLVEKYLPADFDARDAILNDADINLTYCGYIIFLSKDMRHSPITAGVTTKREYRTVVKRVAHDMITRGKAFAAVIEDRLPDYVRLSIHRSTGLNKLSFPLVPQPNHFSMTPWHCCIAVTAKGQFRTAHAIELRETHDVIEQDGRPYYYRDRSDVWKWDVPVEFEFFYPRGIYVRAKPAEGEAAPKLGPKELAKIKELGKGFSPVIPTGFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.1
5 0.1
6 0.09
7 0.08
8 0.08
9 0.08
10 0.09
11 0.11
12 0.12
13 0.15
14 0.15
15 0.19
16 0.21
17 0.27
18 0.27
19 0.25
20 0.25
21 0.25
22 0.28
23 0.26
24 0.26
25 0.25
26 0.24
27 0.27
28 0.26
29 0.23
30 0.22
31 0.25
32 0.25
33 0.22
34 0.22
35 0.2
36 0.22
37 0.22
38 0.23
39 0.19
40 0.21
41 0.23
42 0.26
43 0.25
44 0.23
45 0.23
46 0.2
47 0.19
48 0.16
49 0.15
50 0.12
51 0.12
52 0.14
53 0.13
54 0.11
55 0.12
56 0.13
57 0.13
58 0.12
59 0.15
60 0.15
61 0.16
62 0.17
63 0.18
64 0.19
65 0.19
66 0.18
67 0.15
68 0.13
69 0.12
70 0.12
71 0.13
72 0.1
73 0.09
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.11
81 0.14
82 0.21
83 0.26
84 0.29
85 0.33
86 0.35
87 0.39
88 0.41
89 0.46
90 0.49
91 0.53
92 0.59
93 0.62
94 0.68
95 0.73
96 0.8
97 0.82
98 0.81
99 0.81
100 0.76
101 0.76
102 0.74
103 0.68
104 0.66
105 0.6
106 0.53
107 0.44
108 0.39
109 0.32
110 0.25
111 0.21
112 0.14
113 0.11
114 0.09
115 0.11
116 0.11
117 0.13
118 0.15
119 0.15
120 0.14
121 0.14
122 0.14
123 0.11
124 0.12
125 0.1
126 0.08
127 0.08
128 0.08
129 0.11
130 0.11
131 0.11
132 0.14
133 0.2
134 0.28
135 0.35
136 0.45
137 0.47
138 0.57
139 0.63
140 0.66
141 0.67
142 0.68
143 0.7
144 0.69
145 0.67
146 0.6
147 0.55
148 0.49
149 0.41
150 0.33
151 0.24
152 0.15
153 0.12
154 0.09
155 0.08
156 0.07
157 0.1
158 0.09
159 0.14
160 0.21
161 0.26
162 0.28
163 0.31
164 0.32
165 0.31
166 0.32
167 0.3
168 0.23
169 0.18
170 0.15
171 0.12
172 0.11
173 0.09
174 0.07
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.08
189 0.08
190 0.07
191 0.08
192 0.08
193 0.06
194 0.06
195 0.06
196 0.05
197 0.05
198 0.04
199 0.04
200 0.06
201 0.07
202 0.08
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.06
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.04
216 0.05
217 0.05
218 0.04
219 0.05
220 0.05
221 0.05
222 0.04
223 0.05
224 0.07
225 0.07
226 0.07
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.09
233 0.11
234 0.17
235 0.19
236 0.18
237 0.18
238 0.19
239 0.2
240 0.23
241 0.22
242 0.21
243 0.2
244 0.21
245 0.2
246 0.19
247 0.17
248 0.13
249 0.12
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.08
256 0.08
257 0.08
258 0.1
259 0.11
260 0.11
261 0.12
262 0.11
263 0.11
264 0.12
265 0.12
266 0.13
267 0.12
268 0.11
269 0.12
270 0.12
271 0.12
272 0.13
273 0.15
274 0.14
275 0.16
276 0.17
277 0.16
278 0.16
279 0.18
280 0.15
281 0.14
282 0.12
283 0.09
284 0.09
285 0.09
286 0.09
287 0.07
288 0.07
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.04
299 0.05
300 0.05
301 0.05
302 0.06
303 0.08
304 0.1
305 0.11
306 0.14
307 0.16
308 0.19
309 0.19
310 0.19
311 0.18
312 0.22
313 0.23
314 0.21
315 0.21
316 0.21
317 0.23
318 0.23
319 0.27
320 0.23
321 0.23
322 0.25
323 0.31
324 0.38
325 0.42
326 0.49
327 0.48
328 0.49
329 0.52
330 0.52
331 0.46
332 0.38
333 0.35
334 0.33
335 0.33
336 0.31
337 0.26
338 0.23
339 0.21
340 0.2
341 0.17
342 0.14
343 0.11
344 0.12
345 0.13
346 0.14
347 0.13
348 0.14
349 0.14
350 0.1
351 0.11
352 0.12
353 0.12
354 0.15
355 0.19
356 0.21
357 0.22
358 0.25
359 0.24
360 0.25
361 0.31
362 0.34
363 0.3
364 0.28
365 0.28
366 0.27
367 0.25
368 0.24
369 0.26
370 0.27
371 0.28
372 0.31
373 0.36
374 0.36
375 0.39
376 0.37
377 0.3
378 0.31
379 0.37
380 0.39
381 0.35
382 0.34
383 0.31
384 0.31
385 0.31
386 0.29
387 0.27
388 0.26
389 0.29
390 0.33
391 0.34
392 0.37
393 0.35
394 0.32
395 0.33
396 0.3
397 0.31
398 0.28
399 0.29
400 0.28
401 0.31
402 0.31
403 0.25
404 0.25
405 0.19
406 0.21
407 0.19
408 0.2
409 0.23
410 0.21
411 0.21
412 0.23
413 0.24
414 0.21
415 0.25
416 0.3
417 0.33
418 0.35
419 0.36
420 0.39
421 0.44
422 0.51
423 0.56
424 0.56
425 0.53
426 0.5
427 0.52
428 0.5
429 0.47
430 0.41
431 0.36
432 0.3
433 0.25
434 0.27
435 0.22
436 0.21
437 0.18
438 0.16
439 0.15
440 0.18
441 0.22
442 0.25
443 0.35
444 0.35
445 0.35
446 0.35
447 0.35
448 0.39
449 0.35
450 0.33
451 0.24
452 0.25
453 0.25
454 0.27
455 0.26
456 0.21
457 0.25
458 0.22
459 0.3
460 0.35
461 0.39
462 0.39
463 0.44
464 0.44
465 0.47
466 0.47
467 0.4
468 0.35
469 0.35
470 0.34
471 0.32
472 0.32
473 0.26