Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0V3T0

Protein Details
Accession A0A0L0V3T0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
241-260LKMNMKKYARHLRSIRRRTKBasic
NLS Segment(s)
PositionSequence
246-260KKYARHLRSIRRRTK
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 6.5, mito 4, extr 3
Family & Domain DBs
Amino Acid Sequences MATYMPCERLTGSNDLLVMINPSNNNRFIPLTQERISLWARAIVVNKEVTFANPPNSLPFDFITADEYHSKYQGGRSGSPQRSTSQNHIGAGSPQTPQGTAGDQAINNSTPFANLNELFANHPNLLPVSHFNAMHLGGYMGGPMNWMAAPPPWAMAGFAPNMMHAYAGMPPNPMAPPSSPAPSDGNLDLDDYLRYCHVNIGCQIVKDAFDTLGISHYTDFENFEVAELQEAGLKLANARALKMNMKKYARHLRSIRRRTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.19
5 0.17
6 0.13
7 0.14
8 0.14
9 0.19
10 0.21
11 0.23
12 0.24
13 0.24
14 0.26
15 0.24
16 0.3
17 0.32
18 0.35
19 0.34
20 0.36
21 0.33
22 0.35
23 0.36
24 0.28
25 0.23
26 0.19
27 0.19
28 0.2
29 0.23
30 0.2
31 0.21
32 0.22
33 0.21
34 0.2
35 0.19
36 0.18
37 0.2
38 0.2
39 0.22
40 0.21
41 0.21
42 0.23
43 0.27
44 0.26
45 0.22
46 0.21
47 0.2
48 0.19
49 0.18
50 0.18
51 0.16
52 0.17
53 0.18
54 0.19
55 0.17
56 0.17
57 0.18
58 0.15
59 0.18
60 0.2
61 0.22
62 0.22
63 0.28
64 0.38
65 0.41
66 0.44
67 0.42
68 0.39
69 0.42
70 0.44
71 0.43
72 0.41
73 0.4
74 0.37
75 0.36
76 0.34
77 0.3
78 0.28
79 0.23
80 0.15
81 0.13
82 0.13
83 0.12
84 0.12
85 0.11
86 0.1
87 0.09
88 0.1
89 0.11
90 0.11
91 0.11
92 0.12
93 0.11
94 0.1
95 0.1
96 0.08
97 0.07
98 0.08
99 0.08
100 0.1
101 0.09
102 0.11
103 0.11
104 0.11
105 0.12
106 0.13
107 0.14
108 0.11
109 0.11
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.12
117 0.12
118 0.12
119 0.13
120 0.13
121 0.12
122 0.1
123 0.07
124 0.05
125 0.05
126 0.05
127 0.04
128 0.03
129 0.04
130 0.03
131 0.04
132 0.03
133 0.03
134 0.04
135 0.04
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.08
144 0.07
145 0.08
146 0.07
147 0.07
148 0.08
149 0.07
150 0.07
151 0.05
152 0.05
153 0.08
154 0.09
155 0.1
156 0.1
157 0.1
158 0.11
159 0.12
160 0.11
161 0.1
162 0.1
163 0.13
164 0.15
165 0.17
166 0.16
167 0.18
168 0.2
169 0.19
170 0.21
171 0.18
172 0.18
173 0.15
174 0.16
175 0.14
176 0.12
177 0.11
178 0.09
179 0.09
180 0.08
181 0.08
182 0.08
183 0.12
184 0.13
185 0.16
186 0.17
187 0.23
188 0.24
189 0.23
190 0.25
191 0.2
192 0.2
193 0.18
194 0.17
195 0.1
196 0.1
197 0.1
198 0.09
199 0.11
200 0.1
201 0.1
202 0.09
203 0.1
204 0.11
205 0.11
206 0.13
207 0.11
208 0.12
209 0.11
210 0.12
211 0.12
212 0.11
213 0.12
214 0.1
215 0.09
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.09
222 0.11
223 0.16
224 0.14
225 0.15
226 0.2
227 0.23
228 0.31
229 0.38
230 0.44
231 0.48
232 0.53
233 0.55
234 0.6
235 0.68
236 0.65
237 0.67
238 0.69
239 0.71
240 0.78