Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0VV22

Protein Details
Accession A0A0L0VV22    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-124TQDSNHKNNKAKKTRKTRARKDSEFGHydrophilic
NLS Segment(s)
PositionSequence
107-119NKAKKTRKTRARK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MASAPIPPSLHQTPSRPPSRQSTRIITPVRTDPNFVRPNADLRKTITQERVEGFLTSPANSTISDTPDAASRRSEKRKRSDLNGSQAHLEPNENIMDLTQDSNHKNNKAKKTRKTRARKDSEFGLDNIELYFHQPVFSNGATTFTLEPDAEGQSQSHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.53
4 0.54
5 0.59
6 0.64
7 0.67
8 0.64
9 0.62
10 0.6
11 0.66
12 0.66
13 0.58
14 0.53
15 0.52
16 0.53
17 0.46
18 0.44
19 0.38
20 0.44
21 0.46
22 0.42
23 0.39
24 0.32
25 0.4
26 0.43
27 0.43
28 0.35
29 0.36
30 0.43
31 0.42
32 0.46
33 0.44
34 0.39
35 0.38
36 0.38
37 0.35
38 0.28
39 0.26
40 0.21
41 0.19
42 0.17
43 0.15
44 0.14
45 0.12
46 0.12
47 0.11
48 0.14
49 0.11
50 0.13
51 0.13
52 0.13
53 0.13
54 0.16
55 0.17
56 0.15
57 0.16
58 0.18
59 0.25
60 0.35
61 0.42
62 0.45
63 0.53
64 0.62
65 0.64
66 0.66
67 0.68
68 0.64
69 0.67
70 0.62
71 0.54
72 0.46
73 0.43
74 0.37
75 0.27
76 0.21
77 0.12
78 0.1
79 0.1
80 0.08
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.11
88 0.13
89 0.18
90 0.22
91 0.27
92 0.34
93 0.42
94 0.51
95 0.59
96 0.67
97 0.71
98 0.79
99 0.84
100 0.87
101 0.9
102 0.9
103 0.9
104 0.91
105 0.87
106 0.8
107 0.77
108 0.73
109 0.64
110 0.53
111 0.47
112 0.37
113 0.31
114 0.26
115 0.19
116 0.13
117 0.13
118 0.14
119 0.09
120 0.1
121 0.1
122 0.12
123 0.16
124 0.17
125 0.16
126 0.14
127 0.18
128 0.17
129 0.19
130 0.18
131 0.14
132 0.16
133 0.14
134 0.14
135 0.13
136 0.16
137 0.14
138 0.15